published on Monday, May 4, 2026 by fortinetdev
published on Monday, May 4, 2026 by fortinetdev
Configure IPv4 virtual IP groups.
This resource is a sub resource for variable
dynamic_mappingof resourcefortimanager.ObjectFirewallVipgrp. Conflict and overwrite may occur if use both of them.
Create ObjectFirewallVipgrpDynamicMapping Resource
Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.
Constructor syntax
new ObjectFirewallVipgrpDynamicMapping(name: string, args: ObjectFirewallVipgrpDynamicMappingArgs, opts?: CustomResourceOptions);@overload
def ObjectFirewallVipgrpDynamicMapping(resource_name: str,
args: ObjectFirewallVipgrpDynamicMappingInitArgs,
opts: Optional[ResourceOptions] = None)
@overload
def ObjectFirewallVipgrpDynamicMapping(resource_name: str,
opts: Optional[ResourceOptions] = None,
vipgrp: Optional[str] = None,
_scopes: Optional[Sequence[ObjectFirewallVipgrpDynamicMapping_ScopeArgs]] = None,
adom: Optional[str] = None,
color: Optional[float] = None,
comments: Optional[str] = None,
dynamic_sort_subtable: Optional[str] = None,
interface: Optional[str] = None,
member: Optional[str] = None,
object_firewall_vipgrp_dynamic_mapping_id: Optional[str] = None,
scopetype: Optional[str] = None,
update_if_exist: Optional[bool] = None,
uuid: Optional[str] = None)func NewObjectFirewallVipgrpDynamicMapping(ctx *Context, name string, args ObjectFirewallVipgrpDynamicMappingArgs, opts ...ResourceOption) (*ObjectFirewallVipgrpDynamicMapping, error)public ObjectFirewallVipgrpDynamicMapping(string name, ObjectFirewallVipgrpDynamicMappingArgs args, CustomResourceOptions? opts = null)
public ObjectFirewallVipgrpDynamicMapping(String name, ObjectFirewallVipgrpDynamicMappingArgs args)
public ObjectFirewallVipgrpDynamicMapping(String name, ObjectFirewallVipgrpDynamicMappingArgs args, CustomResourceOptions options)
type: fortimanager:ObjectFirewallVipgrpDynamicMapping
properties: # The arguments to resource properties.
options: # Bag of options to control resource's behavior.
resource "fortimanager_objectfirewallvipgrpdynamicmapping" "name" {
# resource properties
}Parameters
- name string
- The unique name of the resource.
- args ObjectFirewallVipgrpDynamicMappingArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- resource_name str
- The unique name of the resource.
- args ObjectFirewallVipgrpDynamicMappingInitArgs
- The arguments to resource properties.
- opts ResourceOptions
- Bag of options to control resource's behavior.
- ctx Context
- Context object for the current deployment.
- name string
- The unique name of the resource.
- args ObjectFirewallVipgrpDynamicMappingArgs
- The arguments to resource properties.
- opts ResourceOption
- Bag of options to control resource's behavior.
- name string
- The unique name of the resource.
- args ObjectFirewallVipgrpDynamicMappingArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- name String
- The unique name of the resource.
- args ObjectFirewallVipgrpDynamicMappingArgs
- The arguments to resource properties.
- options CustomResourceOptions
- Bag of options to control resource's behavior.
Constructor example
The following reference example uses placeholder values for all input properties.
var objectFirewallVipgrpDynamicMappingResource = new Fortimanager.ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource", new()
{
Vipgrp = "string",
_scopes = new[]
{
new Fortimanager.Inputs.ObjectFirewallVipgrpDynamicMapping_ScopeArgs
{
Name = "string",
Vdom = "string",
},
},
Adom = "string",
Color = 0,
Comments = "string",
DynamicSortSubtable = "string",
Interface = "string",
Member = "string",
ObjectFirewallVipgrpDynamicMappingId = "string",
Scopetype = "string",
UpdateIfExist = false,
Uuid = "string",
});
example, err := fortimanager.NewObjectFirewallVipgrpDynamicMapping(ctx, "objectFirewallVipgrpDynamicMappingResource", &fortimanager.ObjectFirewallVipgrpDynamicMappingArgs{
Vipgrp: pulumi.String("string"),
_scopes: fortimanager.ObjectFirewallVipgrpDynamicMapping_ScopeArray{
&fortimanager.ObjectFirewallVipgrpDynamicMapping_ScopeArgs{
Name: pulumi.String("string"),
Vdom: pulumi.String("string"),
},
},
Adom: pulumi.String("string"),
Color: pulumi.Float64(0),
Comments: pulumi.String("string"),
DynamicSortSubtable: pulumi.String("string"),
Interface: pulumi.String("string"),
Member: pulumi.String("string"),
ObjectFirewallVipgrpDynamicMappingId: pulumi.String("string"),
Scopetype: pulumi.String("string"),
UpdateIfExist: pulumi.Bool(false),
Uuid: pulumi.String("string"),
})
resource "fortimanager_objectfirewallvipgrpdynamicmapping" "objectFirewallVipgrpDynamicMappingResource" {
vipgrp = "string"
_scopes {
name = "string"
vdom = "string"
}
adom = "string"
color = 0
comments = "string"
dynamic_sort_subtable = "string"
interface = "string"
member = "string"
object_firewall_vipgrp_dynamic_mapping_id = "string"
scopetype = "string"
update_if_exist = false
uuid = "string"
}
var objectFirewallVipgrpDynamicMappingResource = new ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource", ObjectFirewallVipgrpDynamicMappingArgs.builder()
.vipgrp("string")
._scopes(ObjectFirewallVipgrpDynamicMapping_ScopeArgs.builder()
.name("string")
.vdom("string")
.build())
.adom("string")
.color(0.0)
.comments("string")
.dynamicSortSubtable("string")
.interface_("string")
.member("string")
.objectFirewallVipgrpDynamicMappingId("string")
.scopetype("string")
.updateIfExist(false)
.uuid("string")
.build());
object_firewall_vipgrp_dynamic_mapping_resource = fortimanager.ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource",
vipgrp="string",
_scopes=[{
"name": "string",
"vdom": "string",
}],
adom="string",
color=float(0),
comments="string",
dynamic_sort_subtable="string",
interface="string",
member="string",
object_firewall_vipgrp_dynamic_mapping_id="string",
scopetype="string",
update_if_exist=False,
uuid="string")
const objectFirewallVipgrpDynamicMappingResource = new fortimanager.ObjectFirewallVipgrpDynamicMapping("objectFirewallVipgrpDynamicMappingResource", {
vipgrp: "string",
_scopes: [{
name: "string",
vdom: "string",
}],
adom: "string",
color: 0,
comments: "string",
dynamicSortSubtable: "string",
"interface": "string",
member: "string",
objectFirewallVipgrpDynamicMappingId: "string",
scopetype: "string",
updateIfExist: false,
uuid: "string",
});
type: fortimanager:ObjectFirewallVipgrpDynamicMapping
properties:
_scopes:
- name: string
vdom: string
adom: string
color: 0
comments: string
dynamicSortSubtable: string
interface: string
member: string
objectFirewallVipgrpDynamicMappingId: string
scopetype: string
updateIfExist: false
uuid: string
vipgrp: string
ObjectFirewallVipgrpDynamicMapping Resource Properties
To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.
Inputs
In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.
The ObjectFirewallVipgrpDynamicMapping resource accepts the following input properties:
- Vipgrp string
- Vipgrp.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Color double
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- Comments string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Interface string
- Interface.
- Member string
- Member VIP objects of the group (Separate multiple objects with a space).
- Object
Firewall stringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- _
scopes List<ObjectFirewall Vipgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below.
- Vipgrp string
- Vipgrp.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Color float64
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- Comments string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Interface string
- Interface.
- Member string
- Member VIP objects of the group (Separate multiple objects with a space).
- Object
Firewall stringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- _
scopes []ObjectFirewall Vipgrp Dynamic Mapping_Scope Args - _Scope. The structure of
_scopeblock is documented below.
- vipgrp string
- Vipgrp.
- _
scopes list(object) - _Scope. The structure of
_scopeblock is documented below. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color number
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments string
- Comment.
- dynamic_
sort_ stringsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface string
- Interface.
- member string
- Member VIP objects of the group (Separate multiple objects with a space).
- object_
firewall_ stringvipgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp String
- Vipgrp.
- _
scopes List<ObjectFirewall Vipgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color Double
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface_ String
- Interface.
- member String
- Member VIP objects of the group (Separate multiple objects with a space).
- object
Firewall StringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp string
- Vipgrp.
- _
scopes ObjectFirewall Vipgrp Dynamic Mapping_Scope[] - _Scope. The structure of
_scopeblock is documented below. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color number
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments string
- Comment.
- dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface string
- Interface.
- member string
- Member VIP objects of the group (Separate multiple objects with a space).
- object
Firewall stringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If booleanExist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp str
- Vipgrp.
- _
scopes Sequence[ObjectFirewall Vipgrp Dynamic Mapping_Scope Args] - _Scope. The structure of
_scopeblock is documented below. - adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color float
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments str
- Comment.
- dynamic_
sort_ strsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface str
- Interface.
- member str
- Member VIP objects of the group (Separate multiple objects with a space).
- object_
firewall_ strvipgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - uuid str
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp String
- Vipgrp.
- _
scopes List<Property Map> - _Scope. The structure of
_scopeblock is documented below. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color Number
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface String
- Interface.
- member String
- Member VIP objects of the group (Separate multiple objects with a space).
- object
Firewall StringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
Outputs
All input properties are implicitly available as output properties. Additionally, the ObjectFirewallVipgrpDynamicMapping resource produces the following output properties:
- Id string
- The provider-assigned unique ID for this managed resource.
- Id string
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id str
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
Look up Existing ObjectFirewallVipgrpDynamicMapping Resource
Get an existing ObjectFirewallVipgrpDynamicMapping resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.
public static get(name: string, id: Input<ID>, state?: ObjectFirewallVipgrpDynamicMappingState, opts?: CustomResourceOptions): ObjectFirewallVipgrpDynamicMapping@staticmethod
def get(resource_name: str,
id: str,
opts: Optional[ResourceOptions] = None,
_scopes: Optional[Sequence[ObjectFirewallVipgrpDynamicMapping_ScopeArgs]] = None,
adom: Optional[str] = None,
color: Optional[float] = None,
comments: Optional[str] = None,
dynamic_sort_subtable: Optional[str] = None,
interface: Optional[str] = None,
member: Optional[str] = None,
object_firewall_vipgrp_dynamic_mapping_id: Optional[str] = None,
scopetype: Optional[str] = None,
update_if_exist: Optional[bool] = None,
uuid: Optional[str] = None,
vipgrp: Optional[str] = None) -> ObjectFirewallVipgrpDynamicMappingfunc GetObjectFirewallVipgrpDynamicMapping(ctx *Context, name string, id IDInput, state *ObjectFirewallVipgrpDynamicMappingState, opts ...ResourceOption) (*ObjectFirewallVipgrpDynamicMapping, error)public static ObjectFirewallVipgrpDynamicMapping Get(string name, Input<string> id, ObjectFirewallVipgrpDynamicMappingState? state, CustomResourceOptions? opts = null)public static ObjectFirewallVipgrpDynamicMapping get(String name, Output<String> id, ObjectFirewallVipgrpDynamicMappingState state, CustomResourceOptions options)resources: _: type: fortimanager:ObjectFirewallVipgrpDynamicMapping get: id: ${id}import {
to = fortimanager_objectfirewallvipgrpdynamicmapping.example
id = "${id}"
}
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- resource_name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Color double
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- Comments string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Interface string
- Interface.
- Member string
- Member VIP objects of the group (Separate multiple objects with a space).
- Object
Firewall stringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Vipgrp string
- Vipgrp.
- _
scopes List<ObjectFirewall Vipgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Color float64
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- Comments string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Interface string
- Interface.
- Member string
- Member VIP objects of the group (Separate multiple objects with a space).
- Object
Firewall stringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Vipgrp string
- Vipgrp.
- _
scopes []ObjectFirewall Vipgrp Dynamic Mapping_Scope Args - _Scope. The structure of
_scopeblock is documented below.
- _
scopes list(object) - _Scope. The structure of
_scopeblock is documented below. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color number
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments string
- Comment.
- dynamic_
sort_ stringsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface string
- Interface.
- member string
- Member VIP objects of the group (Separate multiple objects with a space).
- object_
firewall_ stringvipgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp string
- Vipgrp.
- _
scopes List<ObjectFirewall Vipgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color Double
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface_ String
- Interface.
- member String
- Member VIP objects of the group (Separate multiple objects with a space).
- object
Firewall StringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp String
- Vipgrp.
- _
scopes ObjectFirewall Vipgrp Dynamic Mapping_Scope[] - _Scope. The structure of
_scopeblock is documented below. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color number
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments string
- Comment.
- dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface string
- Interface.
- member string
- Member VIP objects of the group (Separate multiple objects with a space).
- object
Firewall stringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If booleanExist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp string
- Vipgrp.
- _
scopes Sequence[ObjectFirewall Vipgrp Dynamic Mapping_Scope Args] - _Scope. The structure of
_scopeblock is documented below. - adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color float
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments str
- Comment.
- dynamic_
sort_ strsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface str
- Interface.
- member str
- Member VIP objects of the group (Separate multiple objects with a space).
- object_
firewall_ strvipgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update_
if_ boolexist - uuid str
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp str
- Vipgrp.
- _
scopes List<Property Map> - _Scope. The structure of
_scopeblock is documented below. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - color Number
- Integer value to determine the color of the icon in the GUI (range 1 to 32, default = 0, which sets the value to 1).
- comments String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- interface String
- Interface.
- member String
- Member VIP objects of the group (Separate multiple objects with a space).
- object
Firewall StringVipgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- vipgrp String
- Vipgrp.
Supporting Types
ObjectFirewallVipgrpDynamicMapping_Scope, ObjectFirewallVipgrpDynamicMapping_ScopeArgs
Import
ObjectFirewall VipgrpDynamicMapping can be imported using any of these accepted formats:
Set import_options = [“vipgrp=YOUR_VALUE”] in the provider section.
$ export “FORTIMANAGER_IMPORT_TABLE”=“true”
$ pulumi import fortimanager:index/objectFirewallVipgrpDynamicMapping:ObjectFirewallVipgrpDynamicMapping labelname {{_scope.name}}.{{_scope.vdom}}
$ unset “FORTIMANAGER_IMPORT_TABLE”
-> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.
To learn more about importing existing cloud resources, see Importing resources.
Package Details
- Repository
- fortimanager fortinetdev/terraform-provider-fortimanager
- License
- Notes
- This Pulumi package is based on the
fortimanagerTerraform Provider.
published on Monday, May 4, 2026 by fortinetdev