1. Packages
  2. Packages
  3. Fortimanager Provider
  4. API Docs
  5. ObjectFirewallVipDynamicMapping
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev

    Configure virtual IP for IPv4.

    This resource is a sub resource for variable dynamic_mapping of resource fortimanager.ObjectFirewallVip. Conflict and overwrite may occur if use both of them. The following variables have sub resource. Avoid using them together, otherwise conflicts and overwrites may occur.

    • realservers: fortimanager_object_firewall_vip_dynamic_mapping_realservers
    • ssl_cipher_suites: fortimanager_object_firewall_vip_dynamic_mapping_sslciphersuites

    Create ObjectFirewallVipDynamicMapping Resource

    Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.

    Constructor syntax

    new ObjectFirewallVipDynamicMapping(name: string, args: ObjectFirewallVipDynamicMappingArgs, opts?: CustomResourceOptions);
    @overload
    def ObjectFirewallVipDynamicMapping(resource_name: str,
                                        args: ObjectFirewallVipDynamicMappingInitArgs,
                                        opts: Optional[ResourceOptions] = None)
    
    @overload
    def ObjectFirewallVipDynamicMapping(resource_name: str,
                                        opts: Optional[ResourceOptions] = None,
                                        vip: Optional[str] = None,
                                        _scopes: Optional[Sequence[ObjectFirewallVipDynamicMapping_ScopeArgs]] = None,
                                        add_nat46_route: Optional[str] = None,
                                        adom: Optional[str] = None,
                                        arp_reply: Optional[str] = None,
                                        client_cert: Optional[str] = None,
                                        color: Optional[float] = None,
                                        comment: Optional[str] = None,
                                        dns_mapping_ttl: Optional[float] = None,
                                        dynamic_sort_subtable: Optional[str] = None,
                                        empty_cert_action: Optional[str] = None,
                                        extaddr: Optional[str] = None,
                                        extintf: Optional[str] = None,
                                        extip: Optional[str] = None,
                                        extport: Optional[str] = None,
                                        fosid: Optional[float] = None,
                                        gratuitous_arp_interval: Optional[float] = None,
                                        gslb_domain_name: Optional[str] = None,
                                        gslb_hostname: Optional[str] = None,
                                        h2_support: Optional[str] = None,
                                        h3_support: Optional[str] = None,
                                        http_cookie_age: Optional[float] = None,
                                        http_cookie_domain: Optional[str] = None,
                                        http_cookie_domain_from_host: Optional[str] = None,
                                        http_cookie_generation: Optional[float] = None,
                                        http_cookie_path: Optional[str] = None,
                                        http_cookie_share: Optional[str] = None,
                                        http_ip_header: Optional[str] = None,
                                        http_ip_header_name: Optional[str] = None,
                                        http_multiplex: Optional[str] = None,
                                        http_multiplex_max_concurrent_request: Optional[float] = None,
                                        http_multiplex_max_request: Optional[float] = None,
                                        http_multiplex_ttl: Optional[float] = None,
                                        http_redirect: Optional[str] = None,
                                        http_supported_max_version: Optional[str] = None,
                                        https_cookie_secure: Optional[str] = None,
                                        ipv6_mappedip: Optional[str] = None,
                                        ipv6_mappedport: Optional[str] = None,
                                        ldb_method: Optional[str] = None,
                                        mapped_addr: Optional[str] = None,
                                        mappedips: Optional[Sequence[str]] = None,
                                        mappedport: Optional[str] = None,
                                        max_embryonic_connections: Optional[float] = None,
                                        monitor: Optional[str] = None,
                                        nat44: Optional[str] = None,
                                        nat46: Optional[str] = None,
                                        nat_source_vip: Optional[str] = None,
                                        object_firewall_vip_dynamic_mapping_id: Optional[str] = None,
                                        one_click_gslb_server: Optional[str] = None,
                                        outlook_web_access: Optional[str] = None,
                                        persistence: Optional[str] = None,
                                        portforward: Optional[str] = None,
                                        portmapping_type: Optional[str] = None,
                                        protocol: Optional[str] = None,
                                        realservers: Optional[Sequence[ObjectFirewallVipDynamicMappingRealserverArgs]] = None,
                                        scopetype: Optional[str] = None,
                                        server_type: Optional[str] = None,
                                        service: Optional[str] = None,
                                        src_filters: Optional[Sequence[str]] = None,
                                        src_vip_filter: Optional[str] = None,
                                        srcintf_filters: Optional[Sequence[str]] = None,
                                        ssl_accept_ffdhe_groups: Optional[str] = None,
                                        ssl_algorithm: Optional[str] = None,
                                        ssl_certificate: Optional[str] = None,
                                        ssl_cipher_suites: Optional[Sequence[ObjectFirewallVipDynamicMappingSslCipherSuiteArgs]] = None,
                                        ssl_client_fallback: Optional[str] = None,
                                        ssl_client_rekey_count: Optional[float] = None,
                                        ssl_client_renegotiation: Optional[str] = None,
                                        ssl_client_session_state_max: Optional[float] = None,
                                        ssl_client_session_state_timeout: Optional[float] = None,
                                        ssl_client_session_state_type: Optional[str] = None,
                                        ssl_dh_bits: Optional[str] = None,
                                        ssl_hpkp: Optional[str] = None,
                                        ssl_hpkp_age: Optional[float] = None,
                                        ssl_hpkp_backup: Optional[str] = None,
                                        ssl_hpkp_include_subdomains: Optional[str] = None,
                                        ssl_hpkp_primary: Optional[str] = None,
                                        ssl_hpkp_report_uri: Optional[str] = None,
                                        ssl_hsts: Optional[str] = None,
                                        ssl_hsts_age: Optional[float] = None,
                                        ssl_hsts_include_subdomains: Optional[str] = None,
                                        ssl_http_location_conversion: Optional[str] = None,
                                        ssl_http_match_host: Optional[str] = None,
                                        ssl_max_version: Optional[str] = None,
                                        ssl_min_version: Optional[str] = None,
                                        ssl_mode: Optional[str] = None,
                                        ssl_pfs: Optional[str] = None,
                                        ssl_send_empty_frags: Optional[str] = None,
                                        ssl_server_algorithm: Optional[str] = None,
                                        ssl_server_max_version: Optional[str] = None,
                                        ssl_server_min_version: Optional[str] = None,
                                        ssl_server_renegotiation: Optional[str] = None,
                                        ssl_server_session_state_max: Optional[float] = None,
                                        ssl_server_session_state_timeout: Optional[float] = None,
                                        ssl_server_session_state_type: Optional[str] = None,
                                        status: Optional[str] = None,
                                        type: Optional[str] = None,
                                        update_if_exist: Optional[bool] = None,
                                        user_agent_detect: Optional[str] = None,
                                        uuid: Optional[str] = None,
                                        vip_id: Optional[float] = None,
                                        weblogic_server: Optional[str] = None,
                                        websphere_server: Optional[str] = None)
    func NewObjectFirewallVipDynamicMapping(ctx *Context, name string, args ObjectFirewallVipDynamicMappingArgs, opts ...ResourceOption) (*ObjectFirewallVipDynamicMapping, error)
    public ObjectFirewallVipDynamicMapping(string name, ObjectFirewallVipDynamicMappingArgs args, CustomResourceOptions? opts = null)
    public ObjectFirewallVipDynamicMapping(String name, ObjectFirewallVipDynamicMappingArgs args)
    public ObjectFirewallVipDynamicMapping(String name, ObjectFirewallVipDynamicMappingArgs args, CustomResourceOptions options)
    
    type: fortimanager:ObjectFirewallVipDynamicMapping
    properties: # The arguments to resource properties.
    options: # Bag of options to control resource's behavior.
    
    
    resource "fortimanager_objectfirewallvipdynamicmapping" "name" {
        # resource properties
    }

    Parameters

    name string
    The unique name of the resource.
    args ObjectFirewallVipDynamicMappingArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    resource_name str
    The unique name of the resource.
    args ObjectFirewallVipDynamicMappingInitArgs
    The arguments to resource properties.
    opts ResourceOptions
    Bag of options to control resource's behavior.
    ctx Context
    Context object for the current deployment.
    name string
    The unique name of the resource.
    args ObjectFirewallVipDynamicMappingArgs
    The arguments to resource properties.
    opts ResourceOption
    Bag of options to control resource's behavior.
    name string
    The unique name of the resource.
    args ObjectFirewallVipDynamicMappingArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    name String
    The unique name of the resource.
    args ObjectFirewallVipDynamicMappingArgs
    The arguments to resource properties.
    options CustomResourceOptions
    Bag of options to control resource's behavior.

    Constructor example

    The following reference example uses placeholder values for all input properties.

    var objectFirewallVipDynamicMappingResource = new Fortimanager.ObjectFirewallVipDynamicMapping("objectFirewallVipDynamicMappingResource", new()
    {
        Vip = "string",
        _scopes = new[]
        {
            new Fortimanager.Inputs.ObjectFirewallVipDynamicMapping_ScopeArgs
            {
                Name = "string",
                Vdom = "string",
            },
        },
        AddNat46Route = "string",
        Adom = "string",
        ArpReply = "string",
        ClientCert = "string",
        Color = 0,
        Comment = "string",
        DnsMappingTtl = 0,
        DynamicSortSubtable = "string",
        EmptyCertAction = "string",
        Extaddr = "string",
        Extintf = "string",
        Extip = "string",
        Extport = "string",
        Fosid = 0,
        GratuitousArpInterval = 0,
        GslbDomainName = "string",
        GslbHostname = "string",
        H2Support = "string",
        H3Support = "string",
        HttpCookieAge = 0,
        HttpCookieDomain = "string",
        HttpCookieDomainFromHost = "string",
        HttpCookieGeneration = 0,
        HttpCookiePath = "string",
        HttpCookieShare = "string",
        HttpIpHeader = "string",
        HttpIpHeaderName = "string",
        HttpMultiplex = "string",
        HttpMultiplexMaxConcurrentRequest = 0,
        HttpMultiplexMaxRequest = 0,
        HttpMultiplexTtl = 0,
        HttpRedirect = "string",
        HttpSupportedMaxVersion = "string",
        HttpsCookieSecure = "string",
        Ipv6Mappedip = "string",
        Ipv6Mappedport = "string",
        LdbMethod = "string",
        MappedAddr = "string",
        Mappedips = new[]
        {
            "string",
        },
        Mappedport = "string",
        MaxEmbryonicConnections = 0,
        Monitor = "string",
        Nat44 = "string",
        Nat46 = "string",
        NatSourceVip = "string",
        ObjectFirewallVipDynamicMappingId = "string",
        OneClickGslbServer = "string",
        OutlookWebAccess = "string",
        Persistence = "string",
        Portforward = "string",
        PortmappingType = "string",
        Protocol = "string",
        Realservers = new[]
        {
            new Fortimanager.Inputs.ObjectFirewallVipDynamicMappingRealserverArgs
            {
                Address = "string",
                ClientIps = new[]
                {
                    "string",
                },
                HealthCheckProto = "string",
                Healthcheck = "string",
                HolddownInterval = 0,
                HttpHost = "string",
                Id = 0,
                Ip = "string",
                MaxConnections = 0,
                Monitor = "string",
                Port = 0,
                Seq = 0,
                Status = "string",
                TranslateHost = "string",
                Type = "string",
                VerifyCert = "string",
                Weight = 0,
            },
        },
        Scopetype = "string",
        ServerType = "string",
        Service = "string",
        SrcFilters = new[]
        {
            "string",
        },
        SrcVipFilter = "string",
        SrcintfFilters = new[]
        {
            "string",
        },
        SslAcceptFfdheGroups = "string",
        SslAlgorithm = "string",
        SslCertificate = "string",
        SslCipherSuites = new[]
        {
            new Fortimanager.Inputs.ObjectFirewallVipDynamicMappingSslCipherSuiteArgs
            {
                Cipher = "string",
                Id = 0,
                Priority = 0,
                Versions = new[]
                {
                    "string",
                },
            },
        },
        SslClientFallback = "string",
        SslClientRekeyCount = 0,
        SslClientRenegotiation = "string",
        SslClientSessionStateMax = 0,
        SslClientSessionStateTimeout = 0,
        SslClientSessionStateType = "string",
        SslDhBits = "string",
        SslHpkp = "string",
        SslHpkpAge = 0,
        SslHpkpBackup = "string",
        SslHpkpIncludeSubdomains = "string",
        SslHpkpPrimary = "string",
        SslHpkpReportUri = "string",
        SslHsts = "string",
        SslHstsAge = 0,
        SslHstsIncludeSubdomains = "string",
        SslHttpLocationConversion = "string",
        SslHttpMatchHost = "string",
        SslMaxVersion = "string",
        SslMinVersion = "string",
        SslMode = "string",
        SslPfs = "string",
        SslSendEmptyFrags = "string",
        SslServerAlgorithm = "string",
        SslServerMaxVersion = "string",
        SslServerMinVersion = "string",
        SslServerRenegotiation = "string",
        SslServerSessionStateMax = 0,
        SslServerSessionStateTimeout = 0,
        SslServerSessionStateType = "string",
        Status = "string",
        Type = "string",
        UpdateIfExist = false,
        UserAgentDetect = "string",
        Uuid = "string",
        VipId = 0,
        WeblogicServer = "string",
        WebsphereServer = "string",
    });
    
    example, err := fortimanager.NewObjectFirewallVipDynamicMapping(ctx, "objectFirewallVipDynamicMappingResource", &fortimanager.ObjectFirewallVipDynamicMappingArgs{
    	Vip: pulumi.String("string"),
    	_scopes: fortimanager.ObjectFirewallVipDynamicMapping_ScopeArray{
    		&fortimanager.ObjectFirewallVipDynamicMapping_ScopeArgs{
    			Name: pulumi.String("string"),
    			Vdom: pulumi.String("string"),
    		},
    	},
    	AddNat46Route:                     pulumi.String("string"),
    	Adom:                              pulumi.String("string"),
    	ArpReply:                          pulumi.String("string"),
    	ClientCert:                        pulumi.String("string"),
    	Color:                             pulumi.Float64(0),
    	Comment:                           pulumi.String("string"),
    	DnsMappingTtl:                     pulumi.Float64(0),
    	DynamicSortSubtable:               pulumi.String("string"),
    	EmptyCertAction:                   pulumi.String("string"),
    	Extaddr:                           pulumi.String("string"),
    	Extintf:                           pulumi.String("string"),
    	Extip:                             pulumi.String("string"),
    	Extport:                           pulumi.String("string"),
    	Fosid:                             pulumi.Float64(0),
    	GratuitousArpInterval:             pulumi.Float64(0),
    	GslbDomainName:                    pulumi.String("string"),
    	GslbHostname:                      pulumi.String("string"),
    	H2Support:                         pulumi.String("string"),
    	H3Support:                         pulumi.String("string"),
    	HttpCookieAge:                     pulumi.Float64(0),
    	HttpCookieDomain:                  pulumi.String("string"),
    	HttpCookieDomainFromHost:          pulumi.String("string"),
    	HttpCookieGeneration:              pulumi.Float64(0),
    	HttpCookiePath:                    pulumi.String("string"),
    	HttpCookieShare:                   pulumi.String("string"),
    	HttpIpHeader:                      pulumi.String("string"),
    	HttpIpHeaderName:                  pulumi.String("string"),
    	HttpMultiplex:                     pulumi.String("string"),
    	HttpMultiplexMaxConcurrentRequest: pulumi.Float64(0),
    	HttpMultiplexMaxRequest:           pulumi.Float64(0),
    	HttpMultiplexTtl:                  pulumi.Float64(0),
    	HttpRedirect:                      pulumi.String("string"),
    	HttpSupportedMaxVersion:           pulumi.String("string"),
    	HttpsCookieSecure:                 pulumi.String("string"),
    	Ipv6Mappedip:                      pulumi.String("string"),
    	Ipv6Mappedport:                    pulumi.String("string"),
    	LdbMethod:                         pulumi.String("string"),
    	MappedAddr:                        pulumi.String("string"),
    	Mappedips: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	Mappedport:                        pulumi.String("string"),
    	MaxEmbryonicConnections:           pulumi.Float64(0),
    	Monitor:                           pulumi.String("string"),
    	Nat44:                             pulumi.String("string"),
    	Nat46:                             pulumi.String("string"),
    	NatSourceVip:                      pulumi.String("string"),
    	ObjectFirewallVipDynamicMappingId: pulumi.String("string"),
    	OneClickGslbServer:                pulumi.String("string"),
    	OutlookWebAccess:                  pulumi.String("string"),
    	Persistence:                       pulumi.String("string"),
    	Portforward:                       pulumi.String("string"),
    	PortmappingType:                   pulumi.String("string"),
    	Protocol:                          pulumi.String("string"),
    	Realservers: fortimanager.ObjectFirewallVipDynamicMappingRealserverArray{
    		&fortimanager.ObjectFirewallVipDynamicMappingRealserverArgs{
    			Address: pulumi.String("string"),
    			ClientIps: pulumi.StringArray{
    				pulumi.String("string"),
    			},
    			HealthCheckProto: pulumi.String("string"),
    			Healthcheck:      pulumi.String("string"),
    			HolddownInterval: pulumi.Float64(0),
    			HttpHost:         pulumi.String("string"),
    			Id:               pulumi.Float64(0),
    			Ip:               pulumi.String("string"),
    			MaxConnections:   pulumi.Float64(0),
    			Monitor:          pulumi.String("string"),
    			Port:             pulumi.Float64(0),
    			Seq:              pulumi.Float64(0),
    			Status:           pulumi.String("string"),
    			TranslateHost:    pulumi.String("string"),
    			Type:             pulumi.String("string"),
    			VerifyCert:       pulumi.String("string"),
    			Weight:           pulumi.Float64(0),
    		},
    	},
    	Scopetype:  pulumi.String("string"),
    	ServerType: pulumi.String("string"),
    	Service:    pulumi.String("string"),
    	SrcFilters: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	SrcVipFilter: pulumi.String("string"),
    	SrcintfFilters: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	SslAcceptFfdheGroups: pulumi.String("string"),
    	SslAlgorithm:         pulumi.String("string"),
    	SslCertificate:       pulumi.String("string"),
    	SslCipherSuites: fortimanager.ObjectFirewallVipDynamicMappingSslCipherSuiteArray{
    		&fortimanager.ObjectFirewallVipDynamicMappingSslCipherSuiteArgs{
    			Cipher:   pulumi.String("string"),
    			Id:       pulumi.Float64(0),
    			Priority: pulumi.Float64(0),
    			Versions: pulumi.StringArray{
    				pulumi.String("string"),
    			},
    		},
    	},
    	SslClientFallback:            pulumi.String("string"),
    	SslClientRekeyCount:          pulumi.Float64(0),
    	SslClientRenegotiation:       pulumi.String("string"),
    	SslClientSessionStateMax:     pulumi.Float64(0),
    	SslClientSessionStateTimeout: pulumi.Float64(0),
    	SslClientSessionStateType:    pulumi.String("string"),
    	SslDhBits:                    pulumi.String("string"),
    	SslHpkp:                      pulumi.String("string"),
    	SslHpkpAge:                   pulumi.Float64(0),
    	SslHpkpBackup:                pulumi.String("string"),
    	SslHpkpIncludeSubdomains:     pulumi.String("string"),
    	SslHpkpPrimary:               pulumi.String("string"),
    	SslHpkpReportUri:             pulumi.String("string"),
    	SslHsts:                      pulumi.String("string"),
    	SslHstsAge:                   pulumi.Float64(0),
    	SslHstsIncludeSubdomains:     pulumi.String("string"),
    	SslHttpLocationConversion:    pulumi.String("string"),
    	SslHttpMatchHost:             pulumi.String("string"),
    	SslMaxVersion:                pulumi.String("string"),
    	SslMinVersion:                pulumi.String("string"),
    	SslMode:                      pulumi.String("string"),
    	SslPfs:                       pulumi.String("string"),
    	SslSendEmptyFrags:            pulumi.String("string"),
    	SslServerAlgorithm:           pulumi.String("string"),
    	SslServerMaxVersion:          pulumi.String("string"),
    	SslServerMinVersion:          pulumi.String("string"),
    	SslServerRenegotiation:       pulumi.String("string"),
    	SslServerSessionStateMax:     pulumi.Float64(0),
    	SslServerSessionStateTimeout: pulumi.Float64(0),
    	SslServerSessionStateType:    pulumi.String("string"),
    	Status:                       pulumi.String("string"),
    	Type:                         pulumi.String("string"),
    	UpdateIfExist:                pulumi.Bool(false),
    	UserAgentDetect:              pulumi.String("string"),
    	Uuid:                         pulumi.String("string"),
    	VipId:                        pulumi.Float64(0),
    	WeblogicServer:               pulumi.String("string"),
    	WebsphereServer:              pulumi.String("string"),
    })
    
    resource "fortimanager_objectfirewallvipdynamicmapping" "objectFirewallVipDynamicMappingResource" {
      vip = "string"
      _scopes {
        name = "string"
        vdom = "string"
      }
      add_nat46_route                        = "string"
      adom                                   = "string"
      arp_reply                              = "string"
      client_cert                            = "string"
      color                                  = 0
      comment                                = "string"
      dns_mapping_ttl                        = 0
      dynamic_sort_subtable                  = "string"
      empty_cert_action                      = "string"
      extaddr                                = "string"
      extintf                                = "string"
      extip                                  = "string"
      extport                                = "string"
      fosid                                  = 0
      gratuitous_arp_interval                = 0
      gslb_domain_name                       = "string"
      gslb_hostname                          = "string"
      h2_support                             = "string"
      h3_support                             = "string"
      http_cookie_age                        = 0
      http_cookie_domain                     = "string"
      http_cookie_domain_from_host           = "string"
      http_cookie_generation                 = 0
      http_cookie_path                       = "string"
      http_cookie_share                      = "string"
      http_ip_header                         = "string"
      http_ip_header_name                    = "string"
      http_multiplex                         = "string"
      http_multiplex_max_concurrent_request  = 0
      http_multiplex_max_request             = 0
      http_multiplex_ttl                     = 0
      http_redirect                          = "string"
      http_supported_max_version             = "string"
      https_cookie_secure                    = "string"
      ipv6_mappedip                          = "string"
      ipv6_mappedport                        = "string"
      ldb_method                             = "string"
      mapped_addr                            = "string"
      mappedips                              = ["string"]
      mappedport                             = "string"
      max_embryonic_connections              = 0
      monitor                                = "string"
      nat44                                  = "string"
      nat46                                  = "string"
      nat_source_vip                         = "string"
      object_firewall_vip_dynamic_mapping_id = "string"
      one_click_gslb_server                  = "string"
      outlook_web_access                     = "string"
      persistence                            = "string"
      portforward                            = "string"
      portmapping_type                       = "string"
      protocol                               = "string"
      realservers {
        address            = "string"
        client_ips         = ["string"]
        health_check_proto = "string"
        healthcheck        = "string"
        holddown_interval  = 0
        http_host          = "string"
        id                 = 0
        ip                 = "string"
        max_connections    = 0
        monitor            = "string"
        port               = 0
        seq                = 0
        status             = "string"
        translate_host     = "string"
        type               = "string"
        verify_cert        = "string"
        weight             = 0
      }
      scopetype               = "string"
      server_type             = "string"
      service                 = "string"
      src_filters             = ["string"]
      src_vip_filter          = "string"
      srcintf_filters         = ["string"]
      ssl_accept_ffdhe_groups = "string"
      ssl_algorithm           = "string"
      ssl_certificate         = "string"
      ssl_cipher_suites {
        cipher   = "string"
        id       = 0
        priority = 0
        versions = ["string"]
      }
      ssl_client_fallback              = "string"
      ssl_client_rekey_count           = 0
      ssl_client_renegotiation         = "string"
      ssl_client_session_state_max     = 0
      ssl_client_session_state_timeout = 0
      ssl_client_session_state_type    = "string"
      ssl_dh_bits                      = "string"
      ssl_hpkp                         = "string"
      ssl_hpkp_age                     = 0
      ssl_hpkp_backup                  = "string"
      ssl_hpkp_include_subdomains      = "string"
      ssl_hpkp_primary                 = "string"
      ssl_hpkp_report_uri              = "string"
      ssl_hsts                         = "string"
      ssl_hsts_age                     = 0
      ssl_hsts_include_subdomains      = "string"
      ssl_http_location_conversion     = "string"
      ssl_http_match_host              = "string"
      ssl_max_version                  = "string"
      ssl_min_version                  = "string"
      ssl_mode                         = "string"
      ssl_pfs                          = "string"
      ssl_send_empty_frags             = "string"
      ssl_server_algorithm             = "string"
      ssl_server_max_version           = "string"
      ssl_server_min_version           = "string"
      ssl_server_renegotiation         = "string"
      ssl_server_session_state_max     = 0
      ssl_server_session_state_timeout = 0
      ssl_server_session_state_type    = "string"
      status                           = "string"
      type                             = "string"
      update_if_exist                  = false
      user_agent_detect                = "string"
      uuid                             = "string"
      vip_id                           = 0
      weblogic_server                  = "string"
      websphere_server                 = "string"
    }
    
    var objectFirewallVipDynamicMappingResource = new ObjectFirewallVipDynamicMapping("objectFirewallVipDynamicMappingResource", ObjectFirewallVipDynamicMappingArgs.builder()
        .vip("string")
        ._scopes(ObjectFirewallVipDynamicMapping_ScopeArgs.builder()
            .name("string")
            .vdom("string")
            .build())
        .addNat46Route("string")
        .adom("string")
        .arpReply("string")
        .clientCert("string")
        .color(0.0)
        .comment("string")
        .dnsMappingTtl(0.0)
        .dynamicSortSubtable("string")
        .emptyCertAction("string")
        .extaddr("string")
        .extintf("string")
        .extip("string")
        .extport("string")
        .fosid(0.0)
        .gratuitousArpInterval(0.0)
        .gslbDomainName("string")
        .gslbHostname("string")
        .h2Support("string")
        .h3Support("string")
        .httpCookieAge(0.0)
        .httpCookieDomain("string")
        .httpCookieDomainFromHost("string")
        .httpCookieGeneration(0.0)
        .httpCookiePath("string")
        .httpCookieShare("string")
        .httpIpHeader("string")
        .httpIpHeaderName("string")
        .httpMultiplex("string")
        .httpMultiplexMaxConcurrentRequest(0.0)
        .httpMultiplexMaxRequest(0.0)
        .httpMultiplexTtl(0.0)
        .httpRedirect("string")
        .httpSupportedMaxVersion("string")
        .httpsCookieSecure("string")
        .ipv6Mappedip("string")
        .ipv6Mappedport("string")
        .ldbMethod("string")
        .mappedAddr("string")
        .mappedips("string")
        .mappedport("string")
        .maxEmbryonicConnections(0.0)
        .monitor("string")
        .nat44("string")
        .nat46("string")
        .natSourceVip("string")
        .objectFirewallVipDynamicMappingId("string")
        .oneClickGslbServer("string")
        .outlookWebAccess("string")
        .persistence("string")
        .portforward("string")
        .portmappingType("string")
        .protocol("string")
        .realservers(ObjectFirewallVipDynamicMappingRealserverArgs.builder()
            .address("string")
            .clientIps("string")
            .healthCheckProto("string")
            .healthcheck("string")
            .holddownInterval(0.0)
            .httpHost("string")
            .id(0.0)
            .ip("string")
            .maxConnections(0.0)
            .monitor("string")
            .port(0.0)
            .seq(0.0)
            .status("string")
            .translateHost("string")
            .type("string")
            .verifyCert("string")
            .weight(0.0)
            .build())
        .scopetype("string")
        .serverType("string")
        .service("string")
        .srcFilters("string")
        .srcVipFilter("string")
        .srcintfFilters("string")
        .sslAcceptFfdheGroups("string")
        .sslAlgorithm("string")
        .sslCertificate("string")
        .sslCipherSuites(ObjectFirewallVipDynamicMappingSslCipherSuiteArgs.builder()
            .cipher("string")
            .id(0.0)
            .priority(0.0)
            .versions("string")
            .build())
        .sslClientFallback("string")
        .sslClientRekeyCount(0.0)
        .sslClientRenegotiation("string")
        .sslClientSessionStateMax(0.0)
        .sslClientSessionStateTimeout(0.0)
        .sslClientSessionStateType("string")
        .sslDhBits("string")
        .sslHpkp("string")
        .sslHpkpAge(0.0)
        .sslHpkpBackup("string")
        .sslHpkpIncludeSubdomains("string")
        .sslHpkpPrimary("string")
        .sslHpkpReportUri("string")
        .sslHsts("string")
        .sslHstsAge(0.0)
        .sslHstsIncludeSubdomains("string")
        .sslHttpLocationConversion("string")
        .sslHttpMatchHost("string")
        .sslMaxVersion("string")
        .sslMinVersion("string")
        .sslMode("string")
        .sslPfs("string")
        .sslSendEmptyFrags("string")
        .sslServerAlgorithm("string")
        .sslServerMaxVersion("string")
        .sslServerMinVersion("string")
        .sslServerRenegotiation("string")
        .sslServerSessionStateMax(0.0)
        .sslServerSessionStateTimeout(0.0)
        .sslServerSessionStateType("string")
        .status("string")
        .type("string")
        .updateIfExist(false)
        .userAgentDetect("string")
        .uuid("string")
        .vipId(0.0)
        .weblogicServer("string")
        .websphereServer("string")
        .build());
    
    object_firewall_vip_dynamic_mapping_resource = fortimanager.ObjectFirewallVipDynamicMapping("objectFirewallVipDynamicMappingResource",
        vip="string",
        _scopes=[{
            "name": "string",
            "vdom": "string",
        }],
        add_nat46_route="string",
        adom="string",
        arp_reply="string",
        client_cert="string",
        color=float(0),
        comment="string",
        dns_mapping_ttl=float(0),
        dynamic_sort_subtable="string",
        empty_cert_action="string",
        extaddr="string",
        extintf="string",
        extip="string",
        extport="string",
        fosid=float(0),
        gratuitous_arp_interval=float(0),
        gslb_domain_name="string",
        gslb_hostname="string",
        h2_support="string",
        h3_support="string",
        http_cookie_age=float(0),
        http_cookie_domain="string",
        http_cookie_domain_from_host="string",
        http_cookie_generation=float(0),
        http_cookie_path="string",
        http_cookie_share="string",
        http_ip_header="string",
        http_ip_header_name="string",
        http_multiplex="string",
        http_multiplex_max_concurrent_request=float(0),
        http_multiplex_max_request=float(0),
        http_multiplex_ttl=float(0),
        http_redirect="string",
        http_supported_max_version="string",
        https_cookie_secure="string",
        ipv6_mappedip="string",
        ipv6_mappedport="string",
        ldb_method="string",
        mapped_addr="string",
        mappedips=["string"],
        mappedport="string",
        max_embryonic_connections=float(0),
        monitor="string",
        nat44="string",
        nat46="string",
        nat_source_vip="string",
        object_firewall_vip_dynamic_mapping_id="string",
        one_click_gslb_server="string",
        outlook_web_access="string",
        persistence="string",
        portforward="string",
        portmapping_type="string",
        protocol="string",
        realservers=[{
            "address": "string",
            "client_ips": ["string"],
            "health_check_proto": "string",
            "healthcheck": "string",
            "holddown_interval": float(0),
            "http_host": "string",
            "id": float(0),
            "ip": "string",
            "max_connections": float(0),
            "monitor": "string",
            "port": float(0),
            "seq": float(0),
            "status": "string",
            "translate_host": "string",
            "type": "string",
            "verify_cert": "string",
            "weight": float(0),
        }],
        scopetype="string",
        server_type="string",
        service="string",
        src_filters=["string"],
        src_vip_filter="string",
        srcintf_filters=["string"],
        ssl_accept_ffdhe_groups="string",
        ssl_algorithm="string",
        ssl_certificate="string",
        ssl_cipher_suites=[{
            "cipher": "string",
            "id": float(0),
            "priority": float(0),
            "versions": ["string"],
        }],
        ssl_client_fallback="string",
        ssl_client_rekey_count=float(0),
        ssl_client_renegotiation="string",
        ssl_client_session_state_max=float(0),
        ssl_client_session_state_timeout=float(0),
        ssl_client_session_state_type="string",
        ssl_dh_bits="string",
        ssl_hpkp="string",
        ssl_hpkp_age=float(0),
        ssl_hpkp_backup="string",
        ssl_hpkp_include_subdomains="string",
        ssl_hpkp_primary="string",
        ssl_hpkp_report_uri="string",
        ssl_hsts="string",
        ssl_hsts_age=float(0),
        ssl_hsts_include_subdomains="string",
        ssl_http_location_conversion="string",
        ssl_http_match_host="string",
        ssl_max_version="string",
        ssl_min_version="string",
        ssl_mode="string",
        ssl_pfs="string",
        ssl_send_empty_frags="string",
        ssl_server_algorithm="string",
        ssl_server_max_version="string",
        ssl_server_min_version="string",
        ssl_server_renegotiation="string",
        ssl_server_session_state_max=float(0),
        ssl_server_session_state_timeout=float(0),
        ssl_server_session_state_type="string",
        status="string",
        type="string",
        update_if_exist=False,
        user_agent_detect="string",
        uuid="string",
        vip_id=float(0),
        weblogic_server="string",
        websphere_server="string")
    
    const objectFirewallVipDynamicMappingResource = new fortimanager.ObjectFirewallVipDynamicMapping("objectFirewallVipDynamicMappingResource", {
        vip: "string",
        _scopes: [{
            name: "string",
            vdom: "string",
        }],
        addNat46Route: "string",
        adom: "string",
        arpReply: "string",
        clientCert: "string",
        color: 0,
        comment: "string",
        dnsMappingTtl: 0,
        dynamicSortSubtable: "string",
        emptyCertAction: "string",
        extaddr: "string",
        extintf: "string",
        extip: "string",
        extport: "string",
        fosid: 0,
        gratuitousArpInterval: 0,
        gslbDomainName: "string",
        gslbHostname: "string",
        h2Support: "string",
        h3Support: "string",
        httpCookieAge: 0,
        httpCookieDomain: "string",
        httpCookieDomainFromHost: "string",
        httpCookieGeneration: 0,
        httpCookiePath: "string",
        httpCookieShare: "string",
        httpIpHeader: "string",
        httpIpHeaderName: "string",
        httpMultiplex: "string",
        httpMultiplexMaxConcurrentRequest: 0,
        httpMultiplexMaxRequest: 0,
        httpMultiplexTtl: 0,
        httpRedirect: "string",
        httpSupportedMaxVersion: "string",
        httpsCookieSecure: "string",
        ipv6Mappedip: "string",
        ipv6Mappedport: "string",
        ldbMethod: "string",
        mappedAddr: "string",
        mappedips: ["string"],
        mappedport: "string",
        maxEmbryonicConnections: 0,
        monitor: "string",
        nat44: "string",
        nat46: "string",
        natSourceVip: "string",
        objectFirewallVipDynamicMappingId: "string",
        oneClickGslbServer: "string",
        outlookWebAccess: "string",
        persistence: "string",
        portforward: "string",
        portmappingType: "string",
        protocol: "string",
        realservers: [{
            address: "string",
            clientIps: ["string"],
            healthCheckProto: "string",
            healthcheck: "string",
            holddownInterval: 0,
            httpHost: "string",
            id: 0,
            ip: "string",
            maxConnections: 0,
            monitor: "string",
            port: 0,
            seq: 0,
            status: "string",
            translateHost: "string",
            type: "string",
            verifyCert: "string",
            weight: 0,
        }],
        scopetype: "string",
        serverType: "string",
        service: "string",
        srcFilters: ["string"],
        srcVipFilter: "string",
        srcintfFilters: ["string"],
        sslAcceptFfdheGroups: "string",
        sslAlgorithm: "string",
        sslCertificate: "string",
        sslCipherSuites: [{
            cipher: "string",
            id: 0,
            priority: 0,
            versions: ["string"],
        }],
        sslClientFallback: "string",
        sslClientRekeyCount: 0,
        sslClientRenegotiation: "string",
        sslClientSessionStateMax: 0,
        sslClientSessionStateTimeout: 0,
        sslClientSessionStateType: "string",
        sslDhBits: "string",
        sslHpkp: "string",
        sslHpkpAge: 0,
        sslHpkpBackup: "string",
        sslHpkpIncludeSubdomains: "string",
        sslHpkpPrimary: "string",
        sslHpkpReportUri: "string",
        sslHsts: "string",
        sslHstsAge: 0,
        sslHstsIncludeSubdomains: "string",
        sslHttpLocationConversion: "string",
        sslHttpMatchHost: "string",
        sslMaxVersion: "string",
        sslMinVersion: "string",
        sslMode: "string",
        sslPfs: "string",
        sslSendEmptyFrags: "string",
        sslServerAlgorithm: "string",
        sslServerMaxVersion: "string",
        sslServerMinVersion: "string",
        sslServerRenegotiation: "string",
        sslServerSessionStateMax: 0,
        sslServerSessionStateTimeout: 0,
        sslServerSessionStateType: "string",
        status: "string",
        type: "string",
        updateIfExist: false,
        userAgentDetect: "string",
        uuid: "string",
        vipId: 0,
        weblogicServer: "string",
        websphereServer: "string",
    });
    
    type: fortimanager:ObjectFirewallVipDynamicMapping
    properties:
        _scopes:
            - name: string
              vdom: string
        addNat46Route: string
        adom: string
        arpReply: string
        clientCert: string
        color: 0
        comment: string
        dnsMappingTtl: 0
        dynamicSortSubtable: string
        emptyCertAction: string
        extaddr: string
        extintf: string
        extip: string
        extport: string
        fosid: 0
        gratuitousArpInterval: 0
        gslbDomainName: string
        gslbHostname: string
        h2Support: string
        h3Support: string
        httpCookieAge: 0
        httpCookieDomain: string
        httpCookieDomainFromHost: string
        httpCookieGeneration: 0
        httpCookiePath: string
        httpCookieShare: string
        httpIpHeader: string
        httpIpHeaderName: string
        httpMultiplex: string
        httpMultiplexMaxConcurrentRequest: 0
        httpMultiplexMaxRequest: 0
        httpMultiplexTtl: 0
        httpRedirect: string
        httpSupportedMaxVersion: string
        httpsCookieSecure: string
        ipv6Mappedip: string
        ipv6Mappedport: string
        ldbMethod: string
        mappedAddr: string
        mappedips:
            - string
        mappedport: string
        maxEmbryonicConnections: 0
        monitor: string
        nat44: string
        nat46: string
        natSourceVip: string
        objectFirewallVipDynamicMappingId: string
        oneClickGslbServer: string
        outlookWebAccess: string
        persistence: string
        portforward: string
        portmappingType: string
        protocol: string
        realservers:
            - address: string
              clientIps:
                - string
              healthCheckProto: string
              healthcheck: string
              holddownInterval: 0
              httpHost: string
              id: 0
              ip: string
              maxConnections: 0
              monitor: string
              port: 0
              seq: 0
              status: string
              translateHost: string
              type: string
              verifyCert: string
              weight: 0
        scopetype: string
        serverType: string
        service: string
        srcFilters:
            - string
        srcVipFilter: string
        srcintfFilters:
            - string
        sslAcceptFfdheGroups: string
        sslAlgorithm: string
        sslCertificate: string
        sslCipherSuites:
            - cipher: string
              id: 0
              priority: 0
              versions:
                - string
        sslClientFallback: string
        sslClientRekeyCount: 0
        sslClientRenegotiation: string
        sslClientSessionStateMax: 0
        sslClientSessionStateTimeout: 0
        sslClientSessionStateType: string
        sslDhBits: string
        sslHpkp: string
        sslHpkpAge: 0
        sslHpkpBackup: string
        sslHpkpIncludeSubdomains: string
        sslHpkpPrimary: string
        sslHpkpReportUri: string
        sslHsts: string
        sslHstsAge: 0
        sslHstsIncludeSubdomains: string
        sslHttpLocationConversion: string
        sslHttpMatchHost: string
        sslMaxVersion: string
        sslMinVersion: string
        sslMode: string
        sslPfs: string
        sslSendEmptyFrags: string
        sslServerAlgorithm: string
        sslServerMaxVersion: string
        sslServerMinVersion: string
        sslServerRenegotiation: string
        sslServerSessionStateMax: 0
        sslServerSessionStateTimeout: 0
        sslServerSessionStateType: string
        status: string
        type: string
        updateIfExist: false
        userAgentDetect: string
        uuid: string
        vip: string
        vipId: 0
        weblogicServer: string
        websphereServer: string
    

    ObjectFirewallVipDynamicMapping Resource Properties

    To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.

    Inputs

    In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.

    The ObjectFirewallVipDynamicMapping resource accepts the following input properties:

    Vip string
    Vip.
    AddNat46Route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    ArpReply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    ClientCert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    Color double
    Color of icon on the GUI.
    Comment string
    Comment.
    DnsMappingTtl double
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmptyCertAction string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    Extaddr string
    External FQDN address name.
    Extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    Extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    Extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    Fosid double
    Custom defined ID.
    GratuitousArpInterval double
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    GslbDomainName string
    Domain to use when integrating with FortiGSLB.
    GslbHostname string
    Hostname to use within the configured FortiGSLB domain.
    H2Support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    H3Support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    HttpCookieAge double
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    HttpCookieDomain string
    Domain that HTTP cookie persistence should apply to.
    HttpCookieDomainFromHost string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    HttpCookieGeneration double
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    HttpCookiePath string
    Limit HTTP cookie persistence to the specified path.
    HttpCookieShare string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    HttpIpHeader string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    HttpIpHeaderName string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    HttpMultiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    HttpMultiplexMaxConcurrentRequest double
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    HttpMultiplexMaxRequest double
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    HttpMultiplexTtl double
    Time-to-live for idle connections to servers.
    HttpRedirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    HttpSupportedMaxVersion string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    HttpsCookieSecure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    Ipv6Mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    Ipv6Mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    LdbMethod string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    MappedAddr string
    Mapped FQDN address name.
    Mappedips List<string>
    IP address or address range on the destination network to which the external IP address is mapped.
    Mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    MaxEmbryonicConnections double
    Maximum number of incomplete connections.
    Monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    Nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    NatSourceVip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    ObjectFirewallVipDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    OneClickGslbServer string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    OutlookWebAccess string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    Persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    Portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    PortmappingType string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    Protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    Realservers List<ObjectFirewallVipDynamicMappingRealserver>
    Realservers. The structure of realservers block is documented below.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    ServerType string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    Service string
    Service name.
    SrcFilters List<string>
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    SrcVipFilter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    SrcintfFilters List<string>
    Interfaces to which the VIP applies. Separate the names with spaces.
    SslAcceptFfdheGroups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    SslAlgorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    SslCertificate string
    The name of the SSL certificate to use for SSL acceleration.
    SslCipherSuites List<ObjectFirewallVipDynamicMappingSslCipherSuite>
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    SslClientFallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    SslClientRekeyCount double
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    SslClientRenegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    SslClientSessionStateMax double
    Maximum number of client to FortiGate SSL session states to keep.
    SslClientSessionStateTimeout double
    Number of minutes to keep client to FortiGate SSL session state.
    SslClientSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    SslDhBits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    SslHpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    SslHpkpAge double
    Number of seconds the client should honour the HPKP setting.
    SslHpkpBackup string
    Certificate to generate backup HPKP pin from.
    SslHpkpIncludeSubdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    SslHpkpPrimary string
    Certificate to generate primary HPKP pin from.
    SslHpkpReportUri string
    URL to report HPKP violations to.
    SslHsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    SslHstsAge double
    Number of seconds the client should honour the HSTS setting.
    SslHstsIncludeSubdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    SslHttpLocationConversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    SslHttpMatchHost string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    SslMaxVersion string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMinVersion string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    SslPfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    SslSendEmptyFrags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    SslServerAlgorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    SslServerMaxVersion string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerMinVersion string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerRenegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    SslServerSessionStateMax double
    Maximum number of FortiGate to Server SSL session states to keep.
    SslServerSessionStateTimeout double
    Number of minutes to keep FortiGate to Server SSL session state.
    SslServerSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    Status string
    Status. Valid values: disable, enable.
    Type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    UpdateIfExist bool
    UserAgentDetect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    VipId double
    vip id.
    WeblogicServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    WebsphereServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes List<ObjectFirewallVipDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    Vip string
    Vip.
    AddNat46Route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    ArpReply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    ClientCert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    Color float64
    Color of icon on the GUI.
    Comment string
    Comment.
    DnsMappingTtl float64
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmptyCertAction string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    Extaddr string
    External FQDN address name.
    Extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    Extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    Extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    Fosid float64
    Custom defined ID.
    GratuitousArpInterval float64
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    GslbDomainName string
    Domain to use when integrating with FortiGSLB.
    GslbHostname string
    Hostname to use within the configured FortiGSLB domain.
    H2Support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    H3Support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    HttpCookieAge float64
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    HttpCookieDomain string
    Domain that HTTP cookie persistence should apply to.
    HttpCookieDomainFromHost string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    HttpCookieGeneration float64
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    HttpCookiePath string
    Limit HTTP cookie persistence to the specified path.
    HttpCookieShare string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    HttpIpHeader string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    HttpIpHeaderName string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    HttpMultiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    HttpMultiplexMaxConcurrentRequest float64
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    HttpMultiplexMaxRequest float64
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    HttpMultiplexTtl float64
    Time-to-live for idle connections to servers.
    HttpRedirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    HttpSupportedMaxVersion string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    HttpsCookieSecure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    Ipv6Mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    Ipv6Mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    LdbMethod string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    MappedAddr string
    Mapped FQDN address name.
    Mappedips []string
    IP address or address range on the destination network to which the external IP address is mapped.
    Mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    MaxEmbryonicConnections float64
    Maximum number of incomplete connections.
    Monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    Nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    NatSourceVip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    ObjectFirewallVipDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    OneClickGslbServer string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    OutlookWebAccess string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    Persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    Portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    PortmappingType string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    Protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    Realservers []ObjectFirewallVipDynamicMappingRealserverArgs
    Realservers. The structure of realservers block is documented below.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    ServerType string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    Service string
    Service name.
    SrcFilters []string
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    SrcVipFilter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    SrcintfFilters []string
    Interfaces to which the VIP applies. Separate the names with spaces.
    SslAcceptFfdheGroups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    SslAlgorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    SslCertificate string
    The name of the SSL certificate to use for SSL acceleration.
    SslCipherSuites []ObjectFirewallVipDynamicMappingSslCipherSuiteArgs
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    SslClientFallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    SslClientRekeyCount float64
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    SslClientRenegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    SslClientSessionStateMax float64
    Maximum number of client to FortiGate SSL session states to keep.
    SslClientSessionStateTimeout float64
    Number of minutes to keep client to FortiGate SSL session state.
    SslClientSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    SslDhBits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    SslHpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    SslHpkpAge float64
    Number of seconds the client should honour the HPKP setting.
    SslHpkpBackup string
    Certificate to generate backup HPKP pin from.
    SslHpkpIncludeSubdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    SslHpkpPrimary string
    Certificate to generate primary HPKP pin from.
    SslHpkpReportUri string
    URL to report HPKP violations to.
    SslHsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    SslHstsAge float64
    Number of seconds the client should honour the HSTS setting.
    SslHstsIncludeSubdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    SslHttpLocationConversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    SslHttpMatchHost string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    SslMaxVersion string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMinVersion string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    SslPfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    SslSendEmptyFrags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    SslServerAlgorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    SslServerMaxVersion string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerMinVersion string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerRenegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    SslServerSessionStateMax float64
    Maximum number of FortiGate to Server SSL session states to keep.
    SslServerSessionStateTimeout float64
    Number of minutes to keep FortiGate to Server SSL session state.
    SslServerSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    Status string
    Status. Valid values: disable, enable.
    Type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    UpdateIfExist bool
    UserAgentDetect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    VipId float64
    vip id.
    WeblogicServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    WebsphereServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes []ObjectFirewallVipDynamicMapping_ScopeArgs
    _Scope. The structure of _scope block is documented below.
    vip string
    Vip.
    _scopes list(object)
    _Scope. The structure of _scope block is documented below.
    add_nat46_route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arp_reply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    client_cert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color number
    Color of icon on the GUI.
    comment string
    Comment.
    dns_mapping_ttl number
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamic_sort_subtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    empty_cert_action string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr string
    External FQDN address name.
    extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid number
    Custom defined ID.
    gratuitous_arp_interval number
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslb_domain_name string
    Domain to use when integrating with FortiGSLB.
    gslb_hostname string
    Hostname to use within the configured FortiGSLB domain.
    h2_support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3_support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    http_cookie_age number
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    http_cookie_domain string
    Domain that HTTP cookie persistence should apply to.
    http_cookie_domain_from_host string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    http_cookie_generation number
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    http_cookie_path string
    Limit HTTP cookie persistence to the specified path.
    http_cookie_share string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    http_ip_header string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    http_ip_header_name string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    http_multiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    http_multiplex_max_concurrent_request number
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    http_multiplex_max_request number
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    http_multiplex_ttl number
    Time-to-live for idle connections to servers.
    http_redirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    http_supported_max_version string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    https_cookie_secure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6_mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6_mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldb_method string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mapped_addr string
    Mapped FQDN address name.
    mappedips list(string)
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    max_embryonic_connections number
    Maximum number of incomplete connections.
    monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    nat_source_vip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    object_firewall_vip_dynamic_mapping_id string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    one_click_gslb_server string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlook_web_access string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    portmapping_type string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers list(object)
    Realservers. The structure of realservers block is documented below.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    server_type string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service string
    Service name.
    src_filters list(string)
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    src_vip_filter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintf_filters list(string)
    Interfaces to which the VIP applies. Separate the names with spaces.
    ssl_accept_ffdhe_groups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    ssl_algorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    ssl_certificate string
    The name of the SSL certificate to use for SSL acceleration.
    ssl_cipher_suites list(object)
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    ssl_client_fallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    ssl_client_rekey_count number
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    ssl_client_renegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    ssl_client_session_state_max number
    Maximum number of client to FortiGate SSL session states to keep.
    ssl_client_session_state_timeout number
    Number of minutes to keep client to FortiGate SSL session state.
    ssl_client_session_state_type string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    ssl_dh_bits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    ssl_hpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    ssl_hpkp_age number
    Number of seconds the client should honour the HPKP setting.
    ssl_hpkp_backup string
    Certificate to generate backup HPKP pin from.
    ssl_hpkp_include_subdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    ssl_hpkp_primary string
    Certificate to generate primary HPKP pin from.
    ssl_hpkp_report_uri string
    URL to report HPKP violations to.
    ssl_hsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    ssl_hsts_age number
    Number of seconds the client should honour the HSTS setting.
    ssl_hsts_include_subdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    ssl_http_location_conversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    ssl_http_match_host string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    ssl_max_version string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_min_version string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_mode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    ssl_pfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    ssl_send_empty_frags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    ssl_server_algorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    ssl_server_max_version string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_min_version string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_renegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    ssl_server_session_state_max number
    Maximum number of FortiGate to Server SSL session states to keep.
    ssl_server_session_state_timeout number
    Number of minutes to keep FortiGate to Server SSL session state.
    ssl_server_session_state_type string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status string
    Status. Valid values: disable, enable.
    type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    update_if_exist bool
    user_agent_detect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vip_id number
    vip id.
    weblogic_server string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphere_server string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    vip String
    Vip.
    _scopes List<ObjectFirewallVipDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    addNat46Route String
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arpReply String
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    clientCert String
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color Double
    Color of icon on the GUI.
    comment String
    Comment.
    dnsMappingTtl Double
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    emptyCertAction String
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr String
    External FQDN address name.
    extintf String
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip String
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport String
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid Double
    Custom defined ID.
    gratuitousArpInterval Double
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslbDomainName String
    Domain to use when integrating with FortiGSLB.
    gslbHostname String
    Hostname to use within the configured FortiGSLB domain.
    h2Support String
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3Support String
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    httpCookieAge Double
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    httpCookieDomain String
    Domain that HTTP cookie persistence should apply to.
    httpCookieDomainFromHost String
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    httpCookieGeneration Double
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    httpCookiePath String
    Limit HTTP cookie persistence to the specified path.
    httpCookieShare String
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    httpIpHeader String
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    httpIpHeaderName String
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    httpMultiplex String
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    httpMultiplexMaxConcurrentRequest Double
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    httpMultiplexMaxRequest Double
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    httpMultiplexTtl Double
    Time-to-live for idle connections to servers.
    httpRedirect String
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    httpSupportedMaxVersion String
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    httpsCookieSecure String
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6Mappedip String
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6Mappedport String
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldbMethod String
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mappedAddr String
    Mapped FQDN address name.
    mappedips List<String>
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport String
    Port number range on the destination network to which the external port number range is mapped.
    maxEmbryonicConnections Double
    Maximum number of incomplete connections.
    monitor String
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 String
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    natSourceVip String
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    objectFirewallVipDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    oneClickGslbServer String
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlookWebAccess String
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence String
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward String
    Enable/disable port forwarding. Valid values: disable, enable.
    portmappingType String
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol String
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers List<ObjectFirewallVipDynamicMappingRealserver>
    Realservers. The structure of realservers block is documented below.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    serverType String
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service String
    Service name.
    srcFilters List<String>
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    srcVipFilter String
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintfFilters List<String>
    Interfaces to which the VIP applies. Separate the names with spaces.
    sslAcceptFfdheGroups String
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    sslAlgorithm String
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    sslCertificate String
    The name of the SSL certificate to use for SSL acceleration.
    sslCipherSuites List<ObjectFirewallVipDynamicMappingSslCipherSuite>
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    sslClientFallback String
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    sslClientRekeyCount Double
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    sslClientRenegotiation String
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    sslClientSessionStateMax Double
    Maximum number of client to FortiGate SSL session states to keep.
    sslClientSessionStateTimeout Double
    Number of minutes to keep client to FortiGate SSL session state.
    sslClientSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    sslDhBits String
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    sslHpkp String
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    sslHpkpAge Double
    Number of seconds the client should honour the HPKP setting.
    sslHpkpBackup String
    Certificate to generate backup HPKP pin from.
    sslHpkpIncludeSubdomains String
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    sslHpkpPrimary String
    Certificate to generate primary HPKP pin from.
    sslHpkpReportUri String
    URL to report HPKP violations to.
    sslHsts String
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    sslHstsAge Double
    Number of seconds the client should honour the HSTS setting.
    sslHstsIncludeSubdomains String
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    sslHttpLocationConversion String
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    sslHttpMatchHost String
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    sslMaxVersion String
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMinVersion String
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMode String
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    sslPfs String
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    sslSendEmptyFrags String
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    sslServerAlgorithm String
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    sslServerMaxVersion String
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerMinVersion String
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerRenegotiation String
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    sslServerSessionStateMax Double
    Maximum number of FortiGate to Server SSL session states to keep.
    sslServerSessionStateTimeout Double
    Number of minutes to keep FortiGate to Server SSL session state.
    sslServerSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status String
    Status. Valid values: disable, enable.
    type String
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    updateIfExist Boolean
    userAgentDetect String
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipId Double
    vip id.
    weblogicServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphereServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    vip string
    Vip.
    _scopes ObjectFirewallVipDynamicMapping_Scope[]
    _Scope. The structure of _scope block is documented below.
    addNat46Route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arpReply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    clientCert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color number
    Color of icon on the GUI.
    comment string
    Comment.
    dnsMappingTtl number
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    emptyCertAction string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr string
    External FQDN address name.
    extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid number
    Custom defined ID.
    gratuitousArpInterval number
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslbDomainName string
    Domain to use when integrating with FortiGSLB.
    gslbHostname string
    Hostname to use within the configured FortiGSLB domain.
    h2Support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3Support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    httpCookieAge number
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    httpCookieDomain string
    Domain that HTTP cookie persistence should apply to.
    httpCookieDomainFromHost string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    httpCookieGeneration number
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    httpCookiePath string
    Limit HTTP cookie persistence to the specified path.
    httpCookieShare string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    httpIpHeader string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    httpIpHeaderName string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    httpMultiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    httpMultiplexMaxConcurrentRequest number
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    httpMultiplexMaxRequest number
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    httpMultiplexTtl number
    Time-to-live for idle connections to servers.
    httpRedirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    httpSupportedMaxVersion string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    httpsCookieSecure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6Mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6Mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldbMethod string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mappedAddr string
    Mapped FQDN address name.
    mappedips string[]
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    maxEmbryonicConnections number
    Maximum number of incomplete connections.
    monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    natSourceVip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    objectFirewallVipDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    oneClickGslbServer string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlookWebAccess string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    portmappingType string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers ObjectFirewallVipDynamicMappingRealserver[]
    Realservers. The structure of realservers block is documented below.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    serverType string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service string
    Service name.
    srcFilters string[]
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    srcVipFilter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintfFilters string[]
    Interfaces to which the VIP applies. Separate the names with spaces.
    sslAcceptFfdheGroups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    sslAlgorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    sslCertificate string
    The name of the SSL certificate to use for SSL acceleration.
    sslCipherSuites ObjectFirewallVipDynamicMappingSslCipherSuite[]
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    sslClientFallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    sslClientRekeyCount number
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    sslClientRenegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    sslClientSessionStateMax number
    Maximum number of client to FortiGate SSL session states to keep.
    sslClientSessionStateTimeout number
    Number of minutes to keep client to FortiGate SSL session state.
    sslClientSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    sslDhBits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    sslHpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    sslHpkpAge number
    Number of seconds the client should honour the HPKP setting.
    sslHpkpBackup string
    Certificate to generate backup HPKP pin from.
    sslHpkpIncludeSubdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    sslHpkpPrimary string
    Certificate to generate primary HPKP pin from.
    sslHpkpReportUri string
    URL to report HPKP violations to.
    sslHsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    sslHstsAge number
    Number of seconds the client should honour the HSTS setting.
    sslHstsIncludeSubdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    sslHttpLocationConversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    sslHttpMatchHost string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    sslMaxVersion string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMinVersion string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    sslPfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    sslSendEmptyFrags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    sslServerAlgorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    sslServerMaxVersion string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerMinVersion string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerRenegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    sslServerSessionStateMax number
    Maximum number of FortiGate to Server SSL session states to keep.
    sslServerSessionStateTimeout number
    Number of minutes to keep FortiGate to Server SSL session state.
    sslServerSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status string
    Status. Valid values: disable, enable.
    type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    updateIfExist boolean
    userAgentDetect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipId number
    vip id.
    weblogicServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphereServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    vip str
    Vip.
    _scopes Sequence[ObjectFirewallVipDynamicMapping_ScopeArgs]
    _Scope. The structure of _scope block is documented below.
    add_nat46_route str
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arp_reply str
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    client_cert str
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color float
    Color of icon on the GUI.
    comment str
    Comment.
    dns_mapping_ttl float
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamic_sort_subtable str
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    empty_cert_action str
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr str
    External FQDN address name.
    extintf str
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip str
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport str
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid float
    Custom defined ID.
    gratuitous_arp_interval float
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslb_domain_name str
    Domain to use when integrating with FortiGSLB.
    gslb_hostname str
    Hostname to use within the configured FortiGSLB domain.
    h2_support str
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3_support str
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    http_cookie_age float
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    http_cookie_domain str
    Domain that HTTP cookie persistence should apply to.
    http_cookie_domain_from_host str
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    http_cookie_generation float
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    http_cookie_path str
    Limit HTTP cookie persistence to the specified path.
    http_cookie_share str
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    http_ip_header str
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    http_ip_header_name str
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    http_multiplex str
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    http_multiplex_max_concurrent_request float
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    http_multiplex_max_request float
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    http_multiplex_ttl float
    Time-to-live for idle connections to servers.
    http_redirect str
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    http_supported_max_version str
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    https_cookie_secure str
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6_mappedip str
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6_mappedport str
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldb_method str
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mapped_addr str
    Mapped FQDN address name.
    mappedips Sequence[str]
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport str
    Port number range on the destination network to which the external port number range is mapped.
    max_embryonic_connections float
    Maximum number of incomplete connections.
    monitor str
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 str
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 str
    Enable/disable NAT46. Valid values: disable, enable.
    nat_source_vip str
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    object_firewall_vip_dynamic_mapping_id str
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    one_click_gslb_server str
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlook_web_access str
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence str
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward str
    Enable/disable port forwarding. Valid values: disable, enable.
    portmapping_type str
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol str
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers Sequence[ObjectFirewallVipDynamicMappingRealserverArgs]
    Realservers. The structure of realservers block is documented below.
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    server_type str
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service str
    Service name.
    src_filters Sequence[str]
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    src_vip_filter str
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintf_filters Sequence[str]
    Interfaces to which the VIP applies. Separate the names with spaces.
    ssl_accept_ffdhe_groups str
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    ssl_algorithm str
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    ssl_certificate str
    The name of the SSL certificate to use for SSL acceleration.
    ssl_cipher_suites Sequence[ObjectFirewallVipDynamicMappingSslCipherSuiteArgs]
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    ssl_client_fallback str
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    ssl_client_rekey_count float
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    ssl_client_renegotiation str
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    ssl_client_session_state_max float
    Maximum number of client to FortiGate SSL session states to keep.
    ssl_client_session_state_timeout float
    Number of minutes to keep client to FortiGate SSL session state.
    ssl_client_session_state_type str
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    ssl_dh_bits str
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    ssl_hpkp str
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    ssl_hpkp_age float
    Number of seconds the client should honour the HPKP setting.
    ssl_hpkp_backup str
    Certificate to generate backup HPKP pin from.
    ssl_hpkp_include_subdomains str
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    ssl_hpkp_primary str
    Certificate to generate primary HPKP pin from.
    ssl_hpkp_report_uri str
    URL to report HPKP violations to.
    ssl_hsts str
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    ssl_hsts_age float
    Number of seconds the client should honour the HSTS setting.
    ssl_hsts_include_subdomains str
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    ssl_http_location_conversion str
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    ssl_http_match_host str
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    ssl_max_version str
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_min_version str
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_mode str
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    ssl_pfs str
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    ssl_send_empty_frags str
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    ssl_server_algorithm str
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    ssl_server_max_version str
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_min_version str
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_renegotiation str
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    ssl_server_session_state_max float
    Maximum number of FortiGate to Server SSL session states to keep.
    ssl_server_session_state_timeout float
    Number of minutes to keep FortiGate to Server SSL session state.
    ssl_server_session_state_type str
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status str
    Status. Valid values: disable, enable.
    type str
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    update_if_exist bool
    user_agent_detect str
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid str
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vip_id float
    vip id.
    weblogic_server str
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphere_server str
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    vip String
    Vip.
    _scopes List<Property Map>
    _Scope. The structure of _scope block is documented below.
    addNat46Route String
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arpReply String
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    clientCert String
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color Number
    Color of icon on the GUI.
    comment String
    Comment.
    dnsMappingTtl Number
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    emptyCertAction String
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr String
    External FQDN address name.
    extintf String
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip String
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport String
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid Number
    Custom defined ID.
    gratuitousArpInterval Number
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslbDomainName String
    Domain to use when integrating with FortiGSLB.
    gslbHostname String
    Hostname to use within the configured FortiGSLB domain.
    h2Support String
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3Support String
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    httpCookieAge Number
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    httpCookieDomain String
    Domain that HTTP cookie persistence should apply to.
    httpCookieDomainFromHost String
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    httpCookieGeneration Number
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    httpCookiePath String
    Limit HTTP cookie persistence to the specified path.
    httpCookieShare String
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    httpIpHeader String
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    httpIpHeaderName String
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    httpMultiplex String
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    httpMultiplexMaxConcurrentRequest Number
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    httpMultiplexMaxRequest Number
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    httpMultiplexTtl Number
    Time-to-live for idle connections to servers.
    httpRedirect String
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    httpSupportedMaxVersion String
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    httpsCookieSecure String
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6Mappedip String
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6Mappedport String
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldbMethod String
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mappedAddr String
    Mapped FQDN address name.
    mappedips List<String>
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport String
    Port number range on the destination network to which the external port number range is mapped.
    maxEmbryonicConnections Number
    Maximum number of incomplete connections.
    monitor String
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 String
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    natSourceVip String
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    objectFirewallVipDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    oneClickGslbServer String
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlookWebAccess String
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence String
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward String
    Enable/disable port forwarding. Valid values: disable, enable.
    portmappingType String
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol String
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers List<Property Map>
    Realservers. The structure of realservers block is documented below.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    serverType String
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service String
    Service name.
    srcFilters List<String>
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    srcVipFilter String
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintfFilters List<String>
    Interfaces to which the VIP applies. Separate the names with spaces.
    sslAcceptFfdheGroups String
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    sslAlgorithm String
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    sslCertificate String
    The name of the SSL certificate to use for SSL acceleration.
    sslCipherSuites List<Property Map>
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    sslClientFallback String
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    sslClientRekeyCount Number
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    sslClientRenegotiation String
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    sslClientSessionStateMax Number
    Maximum number of client to FortiGate SSL session states to keep.
    sslClientSessionStateTimeout Number
    Number of minutes to keep client to FortiGate SSL session state.
    sslClientSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    sslDhBits String
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    sslHpkp String
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    sslHpkpAge Number
    Number of seconds the client should honour the HPKP setting.
    sslHpkpBackup String
    Certificate to generate backup HPKP pin from.
    sslHpkpIncludeSubdomains String
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    sslHpkpPrimary String
    Certificate to generate primary HPKP pin from.
    sslHpkpReportUri String
    URL to report HPKP violations to.
    sslHsts String
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    sslHstsAge Number
    Number of seconds the client should honour the HSTS setting.
    sslHstsIncludeSubdomains String
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    sslHttpLocationConversion String
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    sslHttpMatchHost String
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    sslMaxVersion String
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMinVersion String
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMode String
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    sslPfs String
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    sslSendEmptyFrags String
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    sslServerAlgorithm String
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    sslServerMaxVersion String
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerMinVersion String
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerRenegotiation String
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    sslServerSessionStateMax Number
    Maximum number of FortiGate to Server SSL session states to keep.
    sslServerSessionStateTimeout Number
    Number of minutes to keep FortiGate to Server SSL session state.
    sslServerSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status String
    Status. Valid values: disable, enable.
    type String
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    updateIfExist Boolean
    userAgentDetect String
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vipId Number
    vip id.
    weblogicServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphereServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.

    Outputs

    All input properties are implicitly available as output properties. Additionally, the ObjectFirewallVipDynamicMapping resource produces the following output properties:

    Id string
    The provider-assigned unique ID for this managed resource.
    Id string
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id str
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.

    Look up Existing ObjectFirewallVipDynamicMapping Resource

    Get an existing ObjectFirewallVipDynamicMapping resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.

    public static get(name: string, id: Input<ID>, state?: ObjectFirewallVipDynamicMappingState, opts?: CustomResourceOptions): ObjectFirewallVipDynamicMapping
    @staticmethod
    def get(resource_name: str,
            id: str,
            opts: Optional[ResourceOptions] = None,
            _scopes: Optional[Sequence[ObjectFirewallVipDynamicMapping_ScopeArgs]] = None,
            add_nat46_route: Optional[str] = None,
            adom: Optional[str] = None,
            arp_reply: Optional[str] = None,
            client_cert: Optional[str] = None,
            color: Optional[float] = None,
            comment: Optional[str] = None,
            dns_mapping_ttl: Optional[float] = None,
            dynamic_sort_subtable: Optional[str] = None,
            empty_cert_action: Optional[str] = None,
            extaddr: Optional[str] = None,
            extintf: Optional[str] = None,
            extip: Optional[str] = None,
            extport: Optional[str] = None,
            fosid: Optional[float] = None,
            gratuitous_arp_interval: Optional[float] = None,
            gslb_domain_name: Optional[str] = None,
            gslb_hostname: Optional[str] = None,
            h2_support: Optional[str] = None,
            h3_support: Optional[str] = None,
            http_cookie_age: Optional[float] = None,
            http_cookie_domain: Optional[str] = None,
            http_cookie_domain_from_host: Optional[str] = None,
            http_cookie_generation: Optional[float] = None,
            http_cookie_path: Optional[str] = None,
            http_cookie_share: Optional[str] = None,
            http_ip_header: Optional[str] = None,
            http_ip_header_name: Optional[str] = None,
            http_multiplex: Optional[str] = None,
            http_multiplex_max_concurrent_request: Optional[float] = None,
            http_multiplex_max_request: Optional[float] = None,
            http_multiplex_ttl: Optional[float] = None,
            http_redirect: Optional[str] = None,
            http_supported_max_version: Optional[str] = None,
            https_cookie_secure: Optional[str] = None,
            ipv6_mappedip: Optional[str] = None,
            ipv6_mappedport: Optional[str] = None,
            ldb_method: Optional[str] = None,
            mapped_addr: Optional[str] = None,
            mappedips: Optional[Sequence[str]] = None,
            mappedport: Optional[str] = None,
            max_embryonic_connections: Optional[float] = None,
            monitor: Optional[str] = None,
            nat44: Optional[str] = None,
            nat46: Optional[str] = None,
            nat_source_vip: Optional[str] = None,
            object_firewall_vip_dynamic_mapping_id: Optional[str] = None,
            one_click_gslb_server: Optional[str] = None,
            outlook_web_access: Optional[str] = None,
            persistence: Optional[str] = None,
            portforward: Optional[str] = None,
            portmapping_type: Optional[str] = None,
            protocol: Optional[str] = None,
            realservers: Optional[Sequence[ObjectFirewallVipDynamicMappingRealserverArgs]] = None,
            scopetype: Optional[str] = None,
            server_type: Optional[str] = None,
            service: Optional[str] = None,
            src_filters: Optional[Sequence[str]] = None,
            src_vip_filter: Optional[str] = None,
            srcintf_filters: Optional[Sequence[str]] = None,
            ssl_accept_ffdhe_groups: Optional[str] = None,
            ssl_algorithm: Optional[str] = None,
            ssl_certificate: Optional[str] = None,
            ssl_cipher_suites: Optional[Sequence[ObjectFirewallVipDynamicMappingSslCipherSuiteArgs]] = None,
            ssl_client_fallback: Optional[str] = None,
            ssl_client_rekey_count: Optional[float] = None,
            ssl_client_renegotiation: Optional[str] = None,
            ssl_client_session_state_max: Optional[float] = None,
            ssl_client_session_state_timeout: Optional[float] = None,
            ssl_client_session_state_type: Optional[str] = None,
            ssl_dh_bits: Optional[str] = None,
            ssl_hpkp: Optional[str] = None,
            ssl_hpkp_age: Optional[float] = None,
            ssl_hpkp_backup: Optional[str] = None,
            ssl_hpkp_include_subdomains: Optional[str] = None,
            ssl_hpkp_primary: Optional[str] = None,
            ssl_hpkp_report_uri: Optional[str] = None,
            ssl_hsts: Optional[str] = None,
            ssl_hsts_age: Optional[float] = None,
            ssl_hsts_include_subdomains: Optional[str] = None,
            ssl_http_location_conversion: Optional[str] = None,
            ssl_http_match_host: Optional[str] = None,
            ssl_max_version: Optional[str] = None,
            ssl_min_version: Optional[str] = None,
            ssl_mode: Optional[str] = None,
            ssl_pfs: Optional[str] = None,
            ssl_send_empty_frags: Optional[str] = None,
            ssl_server_algorithm: Optional[str] = None,
            ssl_server_max_version: Optional[str] = None,
            ssl_server_min_version: Optional[str] = None,
            ssl_server_renegotiation: Optional[str] = None,
            ssl_server_session_state_max: Optional[float] = None,
            ssl_server_session_state_timeout: Optional[float] = None,
            ssl_server_session_state_type: Optional[str] = None,
            status: Optional[str] = None,
            type: Optional[str] = None,
            update_if_exist: Optional[bool] = None,
            user_agent_detect: Optional[str] = None,
            uuid: Optional[str] = None,
            vip: Optional[str] = None,
            vip_id: Optional[float] = None,
            weblogic_server: Optional[str] = None,
            websphere_server: Optional[str] = None) -> ObjectFirewallVipDynamicMapping
    func GetObjectFirewallVipDynamicMapping(ctx *Context, name string, id IDInput, state *ObjectFirewallVipDynamicMappingState, opts ...ResourceOption) (*ObjectFirewallVipDynamicMapping, error)
    public static ObjectFirewallVipDynamicMapping Get(string name, Input<string> id, ObjectFirewallVipDynamicMappingState? state, CustomResourceOptions? opts = null)
    public static ObjectFirewallVipDynamicMapping get(String name, Output<String> id, ObjectFirewallVipDynamicMappingState state, CustomResourceOptions options)
    resources:  _:    type: fortimanager:ObjectFirewallVipDynamicMapping    get:      id: ${id}
    import {
      to = fortimanager_objectfirewallvipdynamicmapping.example
      id = "${id}"
    }
    
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    resource_name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    The following state arguments are supported:
    AddNat46Route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    ArpReply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    ClientCert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    Color double
    Color of icon on the GUI.
    Comment string
    Comment.
    DnsMappingTtl double
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmptyCertAction string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    Extaddr string
    External FQDN address name.
    Extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    Extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    Extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    Fosid double
    Custom defined ID.
    GratuitousArpInterval double
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    GslbDomainName string
    Domain to use when integrating with FortiGSLB.
    GslbHostname string
    Hostname to use within the configured FortiGSLB domain.
    H2Support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    H3Support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    HttpCookieAge double
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    HttpCookieDomain string
    Domain that HTTP cookie persistence should apply to.
    HttpCookieDomainFromHost string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    HttpCookieGeneration double
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    HttpCookiePath string
    Limit HTTP cookie persistence to the specified path.
    HttpCookieShare string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    HttpIpHeader string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    HttpIpHeaderName string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    HttpMultiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    HttpMultiplexMaxConcurrentRequest double
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    HttpMultiplexMaxRequest double
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    HttpMultiplexTtl double
    Time-to-live for idle connections to servers.
    HttpRedirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    HttpSupportedMaxVersion string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    HttpsCookieSecure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    Ipv6Mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    Ipv6Mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    LdbMethod string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    MappedAddr string
    Mapped FQDN address name.
    Mappedips List<string>
    IP address or address range on the destination network to which the external IP address is mapped.
    Mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    MaxEmbryonicConnections double
    Maximum number of incomplete connections.
    Monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    Nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    NatSourceVip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    ObjectFirewallVipDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    OneClickGslbServer string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    OutlookWebAccess string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    Persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    Portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    PortmappingType string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    Protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    Realservers List<ObjectFirewallVipDynamicMappingRealserver>
    Realservers. The structure of realservers block is documented below.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    ServerType string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    Service string
    Service name.
    SrcFilters List<string>
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    SrcVipFilter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    SrcintfFilters List<string>
    Interfaces to which the VIP applies. Separate the names with spaces.
    SslAcceptFfdheGroups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    SslAlgorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    SslCertificate string
    The name of the SSL certificate to use for SSL acceleration.
    SslCipherSuites List<ObjectFirewallVipDynamicMappingSslCipherSuite>
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    SslClientFallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    SslClientRekeyCount double
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    SslClientRenegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    SslClientSessionStateMax double
    Maximum number of client to FortiGate SSL session states to keep.
    SslClientSessionStateTimeout double
    Number of minutes to keep client to FortiGate SSL session state.
    SslClientSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    SslDhBits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    SslHpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    SslHpkpAge double
    Number of seconds the client should honour the HPKP setting.
    SslHpkpBackup string
    Certificate to generate backup HPKP pin from.
    SslHpkpIncludeSubdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    SslHpkpPrimary string
    Certificate to generate primary HPKP pin from.
    SslHpkpReportUri string
    URL to report HPKP violations to.
    SslHsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    SslHstsAge double
    Number of seconds the client should honour the HSTS setting.
    SslHstsIncludeSubdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    SslHttpLocationConversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    SslHttpMatchHost string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    SslMaxVersion string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMinVersion string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    SslPfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    SslSendEmptyFrags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    SslServerAlgorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    SslServerMaxVersion string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerMinVersion string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerRenegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    SslServerSessionStateMax double
    Maximum number of FortiGate to Server SSL session states to keep.
    SslServerSessionStateTimeout double
    Number of minutes to keep FortiGate to Server SSL session state.
    SslServerSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    Status string
    Status. Valid values: disable, enable.
    Type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    UpdateIfExist bool
    UserAgentDetect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    Vip string
    Vip.
    VipId double
    vip id.
    WeblogicServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    WebsphereServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes List<ObjectFirewallVipDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    AddNat46Route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    ArpReply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    ClientCert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    Color float64
    Color of icon on the GUI.
    Comment string
    Comment.
    DnsMappingTtl float64
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmptyCertAction string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    Extaddr string
    External FQDN address name.
    Extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    Extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    Extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    Fosid float64
    Custom defined ID.
    GratuitousArpInterval float64
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    GslbDomainName string
    Domain to use when integrating with FortiGSLB.
    GslbHostname string
    Hostname to use within the configured FortiGSLB domain.
    H2Support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    H3Support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    HttpCookieAge float64
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    HttpCookieDomain string
    Domain that HTTP cookie persistence should apply to.
    HttpCookieDomainFromHost string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    HttpCookieGeneration float64
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    HttpCookiePath string
    Limit HTTP cookie persistence to the specified path.
    HttpCookieShare string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    HttpIpHeader string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    HttpIpHeaderName string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    HttpMultiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    HttpMultiplexMaxConcurrentRequest float64
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    HttpMultiplexMaxRequest float64
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    HttpMultiplexTtl float64
    Time-to-live for idle connections to servers.
    HttpRedirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    HttpSupportedMaxVersion string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    HttpsCookieSecure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    Ipv6Mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    Ipv6Mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    LdbMethod string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    MappedAddr string
    Mapped FQDN address name.
    Mappedips []string
    IP address or address range on the destination network to which the external IP address is mapped.
    Mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    MaxEmbryonicConnections float64
    Maximum number of incomplete connections.
    Monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    Nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    NatSourceVip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    ObjectFirewallVipDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    OneClickGslbServer string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    OutlookWebAccess string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    Persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    Portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    PortmappingType string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    Protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    Realservers []ObjectFirewallVipDynamicMappingRealserverArgs
    Realservers. The structure of realservers block is documented below.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    ServerType string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    Service string
    Service name.
    SrcFilters []string
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    SrcVipFilter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    SrcintfFilters []string
    Interfaces to which the VIP applies. Separate the names with spaces.
    SslAcceptFfdheGroups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    SslAlgorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    SslCertificate string
    The name of the SSL certificate to use for SSL acceleration.
    SslCipherSuites []ObjectFirewallVipDynamicMappingSslCipherSuiteArgs
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    SslClientFallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    SslClientRekeyCount float64
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    SslClientRenegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    SslClientSessionStateMax float64
    Maximum number of client to FortiGate SSL session states to keep.
    SslClientSessionStateTimeout float64
    Number of minutes to keep client to FortiGate SSL session state.
    SslClientSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    SslDhBits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    SslHpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    SslHpkpAge float64
    Number of seconds the client should honour the HPKP setting.
    SslHpkpBackup string
    Certificate to generate backup HPKP pin from.
    SslHpkpIncludeSubdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    SslHpkpPrimary string
    Certificate to generate primary HPKP pin from.
    SslHpkpReportUri string
    URL to report HPKP violations to.
    SslHsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    SslHstsAge float64
    Number of seconds the client should honour the HSTS setting.
    SslHstsIncludeSubdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    SslHttpLocationConversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    SslHttpMatchHost string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    SslMaxVersion string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMinVersion string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    SslMode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    SslPfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    SslSendEmptyFrags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    SslServerAlgorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    SslServerMaxVersion string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerMinVersion string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    SslServerRenegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    SslServerSessionStateMax float64
    Maximum number of FortiGate to Server SSL session states to keep.
    SslServerSessionStateTimeout float64
    Number of minutes to keep FortiGate to Server SSL session state.
    SslServerSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    Status string
    Status. Valid values: disable, enable.
    Type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    UpdateIfExist bool
    UserAgentDetect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    Vip string
    Vip.
    VipId float64
    vip id.
    WeblogicServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    WebsphereServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes []ObjectFirewallVipDynamicMapping_ScopeArgs
    _Scope. The structure of _scope block is documented below.
    _scopes list(object)
    _Scope. The structure of _scope block is documented below.
    add_nat46_route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arp_reply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    client_cert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color number
    Color of icon on the GUI.
    comment string
    Comment.
    dns_mapping_ttl number
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamic_sort_subtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    empty_cert_action string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr string
    External FQDN address name.
    extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid number
    Custom defined ID.
    gratuitous_arp_interval number
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslb_domain_name string
    Domain to use when integrating with FortiGSLB.
    gslb_hostname string
    Hostname to use within the configured FortiGSLB domain.
    h2_support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3_support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    http_cookie_age number
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    http_cookie_domain string
    Domain that HTTP cookie persistence should apply to.
    http_cookie_domain_from_host string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    http_cookie_generation number
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    http_cookie_path string
    Limit HTTP cookie persistence to the specified path.
    http_cookie_share string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    http_ip_header string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    http_ip_header_name string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    http_multiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    http_multiplex_max_concurrent_request number
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    http_multiplex_max_request number
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    http_multiplex_ttl number
    Time-to-live for idle connections to servers.
    http_redirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    http_supported_max_version string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    https_cookie_secure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6_mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6_mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldb_method string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mapped_addr string
    Mapped FQDN address name.
    mappedips list(string)
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    max_embryonic_connections number
    Maximum number of incomplete connections.
    monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    nat_source_vip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    object_firewall_vip_dynamic_mapping_id string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    one_click_gslb_server string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlook_web_access string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    portmapping_type string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers list(object)
    Realservers. The structure of realservers block is documented below.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    server_type string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service string
    Service name.
    src_filters list(string)
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    src_vip_filter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintf_filters list(string)
    Interfaces to which the VIP applies. Separate the names with spaces.
    ssl_accept_ffdhe_groups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    ssl_algorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    ssl_certificate string
    The name of the SSL certificate to use for SSL acceleration.
    ssl_cipher_suites list(object)
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    ssl_client_fallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    ssl_client_rekey_count number
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    ssl_client_renegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    ssl_client_session_state_max number
    Maximum number of client to FortiGate SSL session states to keep.
    ssl_client_session_state_timeout number
    Number of minutes to keep client to FortiGate SSL session state.
    ssl_client_session_state_type string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    ssl_dh_bits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    ssl_hpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    ssl_hpkp_age number
    Number of seconds the client should honour the HPKP setting.
    ssl_hpkp_backup string
    Certificate to generate backup HPKP pin from.
    ssl_hpkp_include_subdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    ssl_hpkp_primary string
    Certificate to generate primary HPKP pin from.
    ssl_hpkp_report_uri string
    URL to report HPKP violations to.
    ssl_hsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    ssl_hsts_age number
    Number of seconds the client should honour the HSTS setting.
    ssl_hsts_include_subdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    ssl_http_location_conversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    ssl_http_match_host string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    ssl_max_version string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_min_version string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_mode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    ssl_pfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    ssl_send_empty_frags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    ssl_server_algorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    ssl_server_max_version string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_min_version string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_renegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    ssl_server_session_state_max number
    Maximum number of FortiGate to Server SSL session states to keep.
    ssl_server_session_state_timeout number
    Number of minutes to keep FortiGate to Server SSL session state.
    ssl_server_session_state_type string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status string
    Status. Valid values: disable, enable.
    type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    update_if_exist bool
    user_agent_detect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vip string
    Vip.
    vip_id number
    vip id.
    weblogic_server string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphere_server string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes List<ObjectFirewallVipDynamicMapping_Scope>
    _Scope. The structure of _scope block is documented below.
    addNat46Route String
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arpReply String
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    clientCert String
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color Double
    Color of icon on the GUI.
    comment String
    Comment.
    dnsMappingTtl Double
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    emptyCertAction String
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr String
    External FQDN address name.
    extintf String
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip String
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport String
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid Double
    Custom defined ID.
    gratuitousArpInterval Double
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslbDomainName String
    Domain to use when integrating with FortiGSLB.
    gslbHostname String
    Hostname to use within the configured FortiGSLB domain.
    h2Support String
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3Support String
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    httpCookieAge Double
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    httpCookieDomain String
    Domain that HTTP cookie persistence should apply to.
    httpCookieDomainFromHost String
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    httpCookieGeneration Double
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    httpCookiePath String
    Limit HTTP cookie persistence to the specified path.
    httpCookieShare String
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    httpIpHeader String
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    httpIpHeaderName String
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    httpMultiplex String
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    httpMultiplexMaxConcurrentRequest Double
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    httpMultiplexMaxRequest Double
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    httpMultiplexTtl Double
    Time-to-live for idle connections to servers.
    httpRedirect String
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    httpSupportedMaxVersion String
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    httpsCookieSecure String
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6Mappedip String
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6Mappedport String
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldbMethod String
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mappedAddr String
    Mapped FQDN address name.
    mappedips List<String>
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport String
    Port number range on the destination network to which the external port number range is mapped.
    maxEmbryonicConnections Double
    Maximum number of incomplete connections.
    monitor String
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 String
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    natSourceVip String
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    objectFirewallVipDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    oneClickGslbServer String
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlookWebAccess String
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence String
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward String
    Enable/disable port forwarding. Valid values: disable, enable.
    portmappingType String
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol String
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers List<ObjectFirewallVipDynamicMappingRealserver>
    Realservers. The structure of realservers block is documented below.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    serverType String
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service String
    Service name.
    srcFilters List<String>
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    srcVipFilter String
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintfFilters List<String>
    Interfaces to which the VIP applies. Separate the names with spaces.
    sslAcceptFfdheGroups String
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    sslAlgorithm String
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    sslCertificate String
    The name of the SSL certificate to use for SSL acceleration.
    sslCipherSuites List<ObjectFirewallVipDynamicMappingSslCipherSuite>
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    sslClientFallback String
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    sslClientRekeyCount Double
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    sslClientRenegotiation String
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    sslClientSessionStateMax Double
    Maximum number of client to FortiGate SSL session states to keep.
    sslClientSessionStateTimeout Double
    Number of minutes to keep client to FortiGate SSL session state.
    sslClientSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    sslDhBits String
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    sslHpkp String
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    sslHpkpAge Double
    Number of seconds the client should honour the HPKP setting.
    sslHpkpBackup String
    Certificate to generate backup HPKP pin from.
    sslHpkpIncludeSubdomains String
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    sslHpkpPrimary String
    Certificate to generate primary HPKP pin from.
    sslHpkpReportUri String
    URL to report HPKP violations to.
    sslHsts String
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    sslHstsAge Double
    Number of seconds the client should honour the HSTS setting.
    sslHstsIncludeSubdomains String
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    sslHttpLocationConversion String
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    sslHttpMatchHost String
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    sslMaxVersion String
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMinVersion String
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMode String
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    sslPfs String
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    sslSendEmptyFrags String
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    sslServerAlgorithm String
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    sslServerMaxVersion String
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerMinVersion String
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerRenegotiation String
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    sslServerSessionStateMax Double
    Maximum number of FortiGate to Server SSL session states to keep.
    sslServerSessionStateTimeout Double
    Number of minutes to keep FortiGate to Server SSL session state.
    sslServerSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status String
    Status. Valid values: disable, enable.
    type String
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    updateIfExist Boolean
    userAgentDetect String
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vip String
    Vip.
    vipId Double
    vip id.
    weblogicServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphereServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes ObjectFirewallVipDynamicMapping_Scope[]
    _Scope. The structure of _scope block is documented below.
    addNat46Route string
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arpReply string
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    clientCert string
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color number
    Color of icon on the GUI.
    comment string
    Comment.
    dnsMappingTtl number
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    emptyCertAction string
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr string
    External FQDN address name.
    extintf string
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip string
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport string
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid number
    Custom defined ID.
    gratuitousArpInterval number
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslbDomainName string
    Domain to use when integrating with FortiGSLB.
    gslbHostname string
    Hostname to use within the configured FortiGSLB domain.
    h2Support string
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3Support string
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    httpCookieAge number
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    httpCookieDomain string
    Domain that HTTP cookie persistence should apply to.
    httpCookieDomainFromHost string
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    httpCookieGeneration number
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    httpCookiePath string
    Limit HTTP cookie persistence to the specified path.
    httpCookieShare string
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    httpIpHeader string
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    httpIpHeaderName string
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    httpMultiplex string
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    httpMultiplexMaxConcurrentRequest number
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    httpMultiplexMaxRequest number
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    httpMultiplexTtl number
    Time-to-live for idle connections to servers.
    httpRedirect string
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    httpSupportedMaxVersion string
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    httpsCookieSecure string
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6Mappedip string
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6Mappedport string
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldbMethod string
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mappedAddr string
    Mapped FQDN address name.
    mappedips string[]
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport string
    Port number range on the destination network to which the external port number range is mapped.
    maxEmbryonicConnections number
    Maximum number of incomplete connections.
    monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 string
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    natSourceVip string
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    objectFirewallVipDynamicMappingId string
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    oneClickGslbServer string
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlookWebAccess string
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence string
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward string
    Enable/disable port forwarding. Valid values: disable, enable.
    portmappingType string
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol string
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers ObjectFirewallVipDynamicMappingRealserver[]
    Realservers. The structure of realservers block is documented below.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    serverType string
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service string
    Service name.
    srcFilters string[]
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    srcVipFilter string
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintfFilters string[]
    Interfaces to which the VIP applies. Separate the names with spaces.
    sslAcceptFfdheGroups string
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    sslAlgorithm string
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    sslCertificate string
    The name of the SSL certificate to use for SSL acceleration.
    sslCipherSuites ObjectFirewallVipDynamicMappingSslCipherSuite[]
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    sslClientFallback string
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    sslClientRekeyCount number
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    sslClientRenegotiation string
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    sslClientSessionStateMax number
    Maximum number of client to FortiGate SSL session states to keep.
    sslClientSessionStateTimeout number
    Number of minutes to keep client to FortiGate SSL session state.
    sslClientSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    sslDhBits string
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    sslHpkp string
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    sslHpkpAge number
    Number of seconds the client should honour the HPKP setting.
    sslHpkpBackup string
    Certificate to generate backup HPKP pin from.
    sslHpkpIncludeSubdomains string
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    sslHpkpPrimary string
    Certificate to generate primary HPKP pin from.
    sslHpkpReportUri string
    URL to report HPKP violations to.
    sslHsts string
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    sslHstsAge number
    Number of seconds the client should honour the HSTS setting.
    sslHstsIncludeSubdomains string
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    sslHttpLocationConversion string
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    sslHttpMatchHost string
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    sslMaxVersion string
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMinVersion string
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMode string
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    sslPfs string
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    sslSendEmptyFrags string
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    sslServerAlgorithm string
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    sslServerMaxVersion string
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerMinVersion string
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerRenegotiation string
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    sslServerSessionStateMax number
    Maximum number of FortiGate to Server SSL session states to keep.
    sslServerSessionStateTimeout number
    Number of minutes to keep FortiGate to Server SSL session state.
    sslServerSessionStateType string
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status string
    Status. Valid values: disable, enable.
    type string
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    updateIfExist boolean
    userAgentDetect string
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vip string
    Vip.
    vipId number
    vip id.
    weblogicServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphereServer string
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes Sequence[ObjectFirewallVipDynamicMapping_ScopeArgs]
    _Scope. The structure of _scope block is documented below.
    add_nat46_route str
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arp_reply str
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    client_cert str
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color float
    Color of icon on the GUI.
    comment str
    Comment.
    dns_mapping_ttl float
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamic_sort_subtable str
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    empty_cert_action str
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr str
    External FQDN address name.
    extintf str
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip str
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport str
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid float
    Custom defined ID.
    gratuitous_arp_interval float
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslb_domain_name str
    Domain to use when integrating with FortiGSLB.
    gslb_hostname str
    Hostname to use within the configured FortiGSLB domain.
    h2_support str
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3_support str
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    http_cookie_age float
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    http_cookie_domain str
    Domain that HTTP cookie persistence should apply to.
    http_cookie_domain_from_host str
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    http_cookie_generation float
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    http_cookie_path str
    Limit HTTP cookie persistence to the specified path.
    http_cookie_share str
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    http_ip_header str
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    http_ip_header_name str
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    http_multiplex str
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    http_multiplex_max_concurrent_request float
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    http_multiplex_max_request float
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    http_multiplex_ttl float
    Time-to-live for idle connections to servers.
    http_redirect str
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    http_supported_max_version str
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    https_cookie_secure str
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6_mappedip str
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6_mappedport str
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldb_method str
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mapped_addr str
    Mapped FQDN address name.
    mappedips Sequence[str]
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport str
    Port number range on the destination network to which the external port number range is mapped.
    max_embryonic_connections float
    Maximum number of incomplete connections.
    monitor str
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 str
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 str
    Enable/disable NAT46. Valid values: disable, enable.
    nat_source_vip str
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    object_firewall_vip_dynamic_mapping_id str
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    one_click_gslb_server str
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlook_web_access str
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence str
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward str
    Enable/disable port forwarding. Valid values: disable, enable.
    portmapping_type str
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol str
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers Sequence[ObjectFirewallVipDynamicMappingRealserverArgs]
    Realservers. The structure of realservers block is documented below.
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    server_type str
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service str
    Service name.
    src_filters Sequence[str]
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    src_vip_filter str
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintf_filters Sequence[str]
    Interfaces to which the VIP applies. Separate the names with spaces.
    ssl_accept_ffdhe_groups str
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    ssl_algorithm str
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    ssl_certificate str
    The name of the SSL certificate to use for SSL acceleration.
    ssl_cipher_suites Sequence[ObjectFirewallVipDynamicMappingSslCipherSuiteArgs]
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    ssl_client_fallback str
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    ssl_client_rekey_count float
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    ssl_client_renegotiation str
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    ssl_client_session_state_max float
    Maximum number of client to FortiGate SSL session states to keep.
    ssl_client_session_state_timeout float
    Number of minutes to keep client to FortiGate SSL session state.
    ssl_client_session_state_type str
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    ssl_dh_bits str
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    ssl_hpkp str
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    ssl_hpkp_age float
    Number of seconds the client should honour the HPKP setting.
    ssl_hpkp_backup str
    Certificate to generate backup HPKP pin from.
    ssl_hpkp_include_subdomains str
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    ssl_hpkp_primary str
    Certificate to generate primary HPKP pin from.
    ssl_hpkp_report_uri str
    URL to report HPKP violations to.
    ssl_hsts str
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    ssl_hsts_age float
    Number of seconds the client should honour the HSTS setting.
    ssl_hsts_include_subdomains str
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    ssl_http_location_conversion str
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    ssl_http_match_host str
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    ssl_max_version str
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_min_version str
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    ssl_mode str
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    ssl_pfs str
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    ssl_send_empty_frags str
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    ssl_server_algorithm str
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    ssl_server_max_version str
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_min_version str
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    ssl_server_renegotiation str
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    ssl_server_session_state_max float
    Maximum number of FortiGate to Server SSL session states to keep.
    ssl_server_session_state_timeout float
    Number of minutes to keep FortiGate to Server SSL session state.
    ssl_server_session_state_type str
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status str
    Status. Valid values: disable, enable.
    type str
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    update_if_exist bool
    user_agent_detect str
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid str
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vip str
    Vip.
    vip_id float
    vip id.
    weblogic_server str
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphere_server str
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.
    _scopes List<Property Map>
    _Scope. The structure of _scope block is documented below.
    addNat46Route String
    Enable/disable adding NAT46 route. Valid values: disable, enable.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    arpReply String
    Enable to respond to ARP requests for this virtual IP address. Enabled by default. Valid values: disable, enable.
    clientCert String
    Enable/disable requesting client certificate. Valid values: disable, enable.
    color Number
    Color of icon on the GUI.
    comment String
    Comment.
    dnsMappingTtl Number
    DNS mapping TTL (Set to zero to use TTL in DNS response, default = 0).
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    emptyCertAction String
    Action for an empty client certificate. Valid values: accept, block, accept-unmanageable.
    extaddr String
    External FQDN address name.
    extintf String
    Interface connected to the source network that receives the packets that will be forwarded to the destination network.
    extip String
    IP address or address range on the external interface that you want to map to an address or address range on the destination network.
    extport String
    Incoming port number range that you want to map to a port number range on the destination network.
    fosid Number
    Custom defined ID.
    gratuitousArpInterval Number
    Enable to have the VIP send gratuitous ARPs. 0=disabled. Set from 5 up to 8640000 seconds to enable.
    gslbDomainName String
    Domain to use when integrating with FortiGSLB.
    gslbHostname String
    Hostname to use within the configured FortiGSLB domain.
    h2Support String
    Enable/disable HTTP2 support (default = enable). Valid values: disable, enable.
    h3Support String
    Enable/disable HTTP3/QUIC support (default = disable). Valid values: disable, enable.
    httpCookieAge Number
    Time in minutes that client web browsers should keep a cookie. Default is 60 seconds. 0 = no time limit.
    httpCookieDomain String
    Domain that HTTP cookie persistence should apply to.
    httpCookieDomainFromHost String
    Enable/disable use of HTTP cookie domain from host field in HTTP. Valid values: disable, enable.
    httpCookieGeneration Number
    Generation of HTTP cookie to be accepted. Changing invalidates all existing cookies.
    httpCookiePath String
    Limit HTTP cookie persistence to the specified path.
    httpCookieShare String
    Control sharing of cookies across virtual servers. same-ip means a cookie from one virtual server can be used by another. Disable stops cookie sharing. Valid values: disable, same-ip.
    httpIpHeader String
    For HTTP multiplexing, enable to add the original client IP address in the XForwarded-For HTTP header. Valid values: disable, enable.
    httpIpHeaderName String
    For HTTP multiplexing, enter a custom HTTPS header name. The original client IP address is added to this header. If empty, X-Forwarded-For is used.
    httpMultiplex String
    Enable/disable HTTP multiplexing. Valid values: disable, enable.
    httpMultiplexMaxConcurrentRequest Number
    Maximum number of concurrent requests that a multiplex server can handle (default = unlimited).
    httpMultiplexMaxRequest Number
    Maximum number of requests that a multiplex server can handle before disconnecting sessions (default = unlimited).
    httpMultiplexTtl Number
    Time-to-live for idle connections to servers.
    httpRedirect String
    Enable/disable redirection of HTTP to HTTPS Valid values: disable, enable.
    httpSupportedMaxVersion String
    Maximum supported HTTP versions. default = HTTP2 Valid values: http1, http2.
    httpsCookieSecure String
    Enable/disable verification that inserted HTTPS cookies are secure. Valid values: disable, enable.
    ipv6Mappedip String
    Start-mapped-IPv6-address [-end mapped-IPv6-address].
    ipv6Mappedport String
    IPv6 port number range on the destination network to which the external port number range is mapped.
    ldbMethod String
    Method used to distribute sessions to real servers. Valid values: static, round-robin, weighted, least-session, least-rtt, first-alive, http-host.
    mappedAddr String
    Mapped FQDN address name.
    mappedips List<String>
    IP address or address range on the destination network to which the external IP address is mapped.
    mappedport String
    Port number range on the destination network to which the external port number range is mapped.
    maxEmbryonicConnections Number
    Maximum number of incomplete connections.
    monitor String
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    nat44 String
    Enable/disable NAT44. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    natSourceVip String
    Enable/disable forcing the source NAT mapped IP to the external IP for all traffic. Valid values: disable, enable.
    objectFirewallVipDynamicMappingId String
    an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
    oneClickGslbServer String
    Enable/disable one click GSLB server integration with FortiGSLB. Valid values: disable, enable.
    outlookWebAccess String
    Enable to add the Front-End-Https header for Microsoft Outlook Web Access. Valid values: disable, enable.
    persistence String
    Configure how to make sure that clients connect to the same server every time they make a request that is part of the same session. Valid values: none, http-cookie, ssl-session-id.
    portforward String
    Enable/disable port forwarding. Valid values: disable, enable.
    portmappingType String
    Port mapping type. Valid values: 1-to-1, m-to-n.
    protocol String
    Protocol to use when forwarding packets. Valid values: tcp, udp, sctp, icmp.
    realservers List<Property Map>
    Realservers. The structure of realservers block is documented below.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    serverType String
    Protocol to be load balanced by the virtual server (also called the server load balance virtual IP). Valid values: http, https, ssl, tcp, udp, ip, imaps, pop3s, smtps.
    service String
    Service name.
    srcFilters List<String>
    Source address filter. Each address must be either an IP/subnet (x.x.x.x/n) or a range (x.x.x.x-y.y.y.y). Separate addresses with spaces.
    srcVipFilter String
    Enable/disable use of 'src-filter' to match destinations for the reverse SNAT rule. Valid values: disable, enable.
    srcintfFilters List<String>
    Interfaces to which the VIP applies. Separate the names with spaces.
    sslAcceptFfdheGroups String
    Enable/disable FFDHE cipher suite for SSL key exchange. Valid values: disable, enable.
    sslAlgorithm String
    Permitted encryption algorithms for SSL sessions according to encryption strength. Valid values: high, medium, low, custom.
    sslCertificate String
    The name of the SSL certificate to use for SSL acceleration.
    sslCipherSuites List<Property Map>
    Ssl-Cipher-Suites. The structure of ssl_cipher_suites block is documented below.
    sslClientFallback String
    Enable/disable support for preventing Downgrade Attacks on client connections (RFC 7507). Valid values: disable, enable.
    sslClientRekeyCount Number
    Maximum length of data in MB before triggering a client rekey (0 = disable).
    sslClientRenegotiation String
    Allow, deny, or require secure renegotiation of client sessions to comply with RFC 5746. Valid values: deny, allow, secure.
    sslClientSessionStateMax Number
    Maximum number of client to FortiGate SSL session states to keep.
    sslClientSessionStateTimeout Number
    Number of minutes to keep client to FortiGate SSL session state.
    sslClientSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the client and the FortiGate. Valid values: disable, time, count, both.
    sslDhBits String
    Number of bits to use in the Diffie-Hellman exchange for RSA encryption of SSL sessions. Valid values: 768, 1024, 1536, 2048, 3072, 4096.
    sslHpkp String
    Enable/disable including HPKP header in response. Valid values: disable, enable, report-only.
    sslHpkpAge Number
    Number of seconds the client should honour the HPKP setting.
    sslHpkpBackup String
    Certificate to generate backup HPKP pin from.
    sslHpkpIncludeSubdomains String
    Indicate that HPKP header applies to all subdomains. Valid values: disable, enable.
    sslHpkpPrimary String
    Certificate to generate primary HPKP pin from.
    sslHpkpReportUri String
    URL to report HPKP violations to.
    sslHsts String
    Enable/disable including HSTS header in response. Valid values: disable, enable.
    sslHstsAge Number
    Number of seconds the client should honour the HSTS setting.
    sslHstsIncludeSubdomains String
    Indicate that HSTS header applies to all subdomains. Valid values: disable, enable.
    sslHttpLocationConversion String
    Enable to replace HTTP with HTTPS in the reply's Location HTTP header field. Valid values: disable, enable.
    sslHttpMatchHost String
    Enable/disable HTTP host matching for location conversion. Valid values: disable, enable.
    sslMaxVersion String
    Highest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMinVersion String
    Lowest SSL/TLS version acceptable from a client. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    sslMode String
    Apply SSL offloading between the client and the FortiGate (half) or from the client to the FortiGate and from the FortiGate to the server (full). Valid values: half, full.
    sslPfs String
    Select the cipher suites that can be used for SSL perfect forward secrecy (PFS). Applies to both client and server sessions. Valid values: require, deny, allow.
    sslSendEmptyFrags String
    Enable/disable sending empty fragments to avoid CBC IV attacks (SSL 3.0 & TLS 1.0 only). May need to be disabled for compatibility with older systems. Valid values: disable, enable.
    sslServerAlgorithm String
    Permitted encryption algorithms for the server side of SSL full mode sessions according to encryption strength. Valid values: high, low, medium, custom, client.
    sslServerMaxVersion String
    Highest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerMinVersion String
    Lowest SSL/TLS version acceptable from a server. Use the client setting by default. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, client, tls-1.3.
    sslServerRenegotiation String
    Enable/disable secure renegotiation to comply with RFC 5746. Valid values: disable, enable.
    sslServerSessionStateMax Number
    Maximum number of FortiGate to Server SSL session states to keep.
    sslServerSessionStateTimeout Number
    Number of minutes to keep FortiGate to Server SSL session state.
    sslServerSessionStateType String
    How to expire SSL sessions for the segment of the SSL connection between the server and the FortiGate. Valid values: disable, time, count, both.
    status String
    Status. Valid values: disable, enable.
    type String
    Configure a static NAT, load balance, server load balance, DNS translation, or FQDN VIP. Valid values: static-nat, load-balance, server-load-balance, dns-translation, fqdn.
    updateIfExist Boolean
    userAgentDetect String
    Enable/disable detecting device type by HTTP user-agent if no client certificate is provided. Valid values: disable, enable.
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    vip String
    Vip.
    vipId Number
    vip id.
    weblogicServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebLogic server. Valid values: disable, enable.
    websphereServer String
    Enable to add an HTTP header to indicate SSL offloading for a WebSphere server. Valid values: disable, enable.

    Supporting Types

    ObjectFirewallVipDynamicMappingRealserver, ObjectFirewallVipDynamicMappingRealserverArgs

    Address string
    Address.
    ClientIps List<string>
    Only clients in this IP range can connect to this real server.
    HealthCheckProto string
    Health-Check-Proto. Valid values: ping, http.
    Healthcheck string
    Enable to check the responsiveness of the real server before forwarding traffic. Valid values: disable, enable, vip.
    HolddownInterval double
    Time in seconds that the health check monitor continues to monitor and unresponsive server that should be active.
    HttpHost string
    HTTP server domain name in HTTP header.
    Id double
    Real server ID.
    Ip string
    IP address of the real server.
    MaxConnections double
    Max number of active connections that can be directed to the real server. When reached, sessions are sent to other real servers.
    Monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    Port double
    Port for communicating with the real server. Required if port forwarding is enabled.
    Seq double
    Seq.
    Status string
    Set the status of the real server to active so that it can accept traffic, or on standby or disabled so no traffic is sent. Valid values: active, standby, disable.
    TranslateHost string
    Enable/disable translation of hostname/IP from virtual server to real server. Valid values: disable, enable.
    Type string
    Type. Valid values: ip, address.
    VerifyCert string
    Verify-Cert. Valid values: disable, enable.
    Weight double
    Weight of the real server. If weighted load balancing is enabled, the server with the highest weight gets more connections.
    Address string
    Address.
    ClientIps []string
    Only clients in this IP range can connect to this real server.
    HealthCheckProto string
    Health-Check-Proto. Valid values: ping, http.
    Healthcheck string
    Enable to check the responsiveness of the real server before forwarding traffic. Valid values: disable, enable, vip.
    HolddownInterval float64
    Time in seconds that the health check monitor continues to monitor and unresponsive server that should be active.
    HttpHost string
    HTTP server domain name in HTTP header.
    Id float64
    Real server ID.
    Ip string
    IP address of the real server.
    MaxConnections float64
    Max number of active connections that can be directed to the real server. When reached, sessions are sent to other real servers.
    Monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    Port float64
    Port for communicating with the real server. Required if port forwarding is enabled.
    Seq float64
    Seq.
    Status string
    Set the status of the real server to active so that it can accept traffic, or on standby or disabled so no traffic is sent. Valid values: active, standby, disable.
    TranslateHost string
    Enable/disable translation of hostname/IP from virtual server to real server. Valid values: disable, enable.
    Type string
    Type. Valid values: ip, address.
    VerifyCert string
    Verify-Cert. Valid values: disable, enable.
    Weight float64
    Weight of the real server. If weighted load balancing is enabled, the server with the highest weight gets more connections.
    address string
    Address.
    client_ips list(string)
    Only clients in this IP range can connect to this real server.
    health_check_proto string
    Health-Check-Proto. Valid values: ping, http.
    healthcheck string
    Enable to check the responsiveness of the real server before forwarding traffic. Valid values: disable, enable, vip.
    holddown_interval number
    Time in seconds that the health check monitor continues to monitor and unresponsive server that should be active.
    http_host string
    HTTP server domain name in HTTP header.
    id number
    Real server ID.
    ip string
    IP address of the real server.
    max_connections number
    Max number of active connections that can be directed to the real server. When reached, sessions are sent to other real servers.
    monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    port number
    Port for communicating with the real server. Required if port forwarding is enabled.
    seq number
    Seq.
    status string
    Set the status of the real server to active so that it can accept traffic, or on standby or disabled so no traffic is sent. Valid values: active, standby, disable.
    translate_host string
    Enable/disable translation of hostname/IP from virtual server to real server. Valid values: disable, enable.
    type string
    Type. Valid values: ip, address.
    verify_cert string
    Verify-Cert. Valid values: disable, enable.
    weight number
    Weight of the real server. If weighted load balancing is enabled, the server with the highest weight gets more connections.
    address String
    Address.
    clientIps List<String>
    Only clients in this IP range can connect to this real server.
    healthCheckProto String
    Health-Check-Proto. Valid values: ping, http.
    healthcheck String
    Enable to check the responsiveness of the real server before forwarding traffic. Valid values: disable, enable, vip.
    holddownInterval Double
    Time in seconds that the health check monitor continues to monitor and unresponsive server that should be active.
    httpHost String
    HTTP server domain name in HTTP header.
    id Double
    Real server ID.
    ip String
    IP address of the real server.
    maxConnections Double
    Max number of active connections that can be directed to the real server. When reached, sessions are sent to other real servers.
    monitor String
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    port Double
    Port for communicating with the real server. Required if port forwarding is enabled.
    seq Double
    Seq.
    status String
    Set the status of the real server to active so that it can accept traffic, or on standby or disabled so no traffic is sent. Valid values: active, standby, disable.
    translateHost String
    Enable/disable translation of hostname/IP from virtual server to real server. Valid values: disable, enable.
    type String
    Type. Valid values: ip, address.
    verifyCert String
    Verify-Cert. Valid values: disable, enable.
    weight Double
    Weight of the real server. If weighted load balancing is enabled, the server with the highest weight gets more connections.
    address string
    Address.
    clientIps string[]
    Only clients in this IP range can connect to this real server.
    healthCheckProto string
    Health-Check-Proto. Valid values: ping, http.
    healthcheck string
    Enable to check the responsiveness of the real server before forwarding traffic. Valid values: disable, enable, vip.
    holddownInterval number
    Time in seconds that the health check monitor continues to monitor and unresponsive server that should be active.
    httpHost string
    HTTP server domain name in HTTP header.
    id number
    Real server ID.
    ip string
    IP address of the real server.
    maxConnections number
    Max number of active connections that can be directed to the real server. When reached, sessions are sent to other real servers.
    monitor string
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    port number
    Port for communicating with the real server. Required if port forwarding is enabled.
    seq number
    Seq.
    status string
    Set the status of the real server to active so that it can accept traffic, or on standby or disabled so no traffic is sent. Valid values: active, standby, disable.
    translateHost string
    Enable/disable translation of hostname/IP from virtual server to real server. Valid values: disable, enable.
    type string
    Type. Valid values: ip, address.
    verifyCert string
    Verify-Cert. Valid values: disable, enable.
    weight number
    Weight of the real server. If weighted load balancing is enabled, the server with the highest weight gets more connections.
    address str
    Address.
    client_ips Sequence[str]
    Only clients in this IP range can connect to this real server.
    health_check_proto str
    Health-Check-Proto. Valid values: ping, http.
    healthcheck str
    Enable to check the responsiveness of the real server before forwarding traffic. Valid values: disable, enable, vip.
    holddown_interval float
    Time in seconds that the health check monitor continues to monitor and unresponsive server that should be active.
    http_host str
    HTTP server domain name in HTTP header.
    id float
    Real server ID.
    ip str
    IP address of the real server.
    max_connections float
    Max number of active connections that can be directed to the real server. When reached, sessions are sent to other real servers.
    monitor str
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    port float
    Port for communicating with the real server. Required if port forwarding is enabled.
    seq float
    Seq.
    status str
    Set the status of the real server to active so that it can accept traffic, or on standby or disabled so no traffic is sent. Valid values: active, standby, disable.
    translate_host str
    Enable/disable translation of hostname/IP from virtual server to real server. Valid values: disable, enable.
    type str
    Type. Valid values: ip, address.
    verify_cert str
    Verify-Cert. Valid values: disable, enable.
    weight float
    Weight of the real server. If weighted load balancing is enabled, the server with the highest weight gets more connections.
    address String
    Address.
    clientIps List<String>
    Only clients in this IP range can connect to this real server.
    healthCheckProto String
    Health-Check-Proto. Valid values: ping, http.
    healthcheck String
    Enable to check the responsiveness of the real server before forwarding traffic. Valid values: disable, enable, vip.
    holddownInterval Number
    Time in seconds that the health check monitor continues to monitor and unresponsive server that should be active.
    httpHost String
    HTTP server domain name in HTTP header.
    id Number
    Real server ID.
    ip String
    IP address of the real server.
    maxConnections Number
    Max number of active connections that can be directed to the real server. When reached, sessions are sent to other real servers.
    monitor String
    Name of the health check monitor to use when polling to determine a virtual server's connectivity status.
    port Number
    Port for communicating with the real server. Required if port forwarding is enabled.
    seq Number
    Seq.
    status String
    Set the status of the real server to active so that it can accept traffic, or on standby or disabled so no traffic is sent. Valid values: active, standby, disable.
    translateHost String
    Enable/disable translation of hostname/IP from virtual server to real server. Valid values: disable, enable.
    type String
    Type. Valid values: ip, address.
    verifyCert String
    Verify-Cert. Valid values: disable, enable.
    weight Number
    Weight of the real server. If weighted load balancing is enabled, the server with the highest weight gets more connections.

    ObjectFirewallVipDynamicMappingSslCipherSuite, ObjectFirewallVipDynamicMappingSslCipherSuiteArgs

    Cipher string
    Cipher suite name. Valid values: TLS-RSA-WITH-RC4-128-MD5, TLS-RSA-WITH-RC4-128-SHA, TLS-RSA-WITH-DES-CBC-SHA, TLS-RSA-WITH-3DES-EDE-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA, TLS-RSA-WITH-AES-256-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA256, TLS-RSA-WITH-AES-256-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-RSA-WITH-SEED-CBC-SHA, TLS-RSA-WITH-ARIA-128-CBC-SHA256, TLS-RSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-RSA-WITH-DES-CBC-SHA, TLS-DHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA, TLS-DHE-RSA-WITH-AES-256-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA256, TLS-DHE-RSA-WITH-AES-256-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-RSA-WITH-SEED-CBC-SHA, TLS-DHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-RC4-128-SHA, TLS-ECDHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA, TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-AES-128-GCM-SHA256, TLS-DHE-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-AES-128-CBC-SHA, TLS-DHE-DSS-WITH-AES-256-CBC-SHA, TLS-DHE-DSS-WITH-AES-128-CBC-SHA256, TLS-DHE-DSS-WITH-AES-128-GCM-SHA256, TLS-DHE-DSS-WITH-AES-256-CBC-SHA256, TLS-DHE-DSS-WITH-AES-256-GCM-SHA384, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384, TLS-RSA-WITH-AES-128-GCM-SHA256, TLS-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-DSS-WITH-SEED-CBC-SHA, TLS-DHE-DSS-WITH-ARIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-DSS-WITH-3DES-EDE-CBC-SHA, TLS-DHE-DSS-WITH-DES-CBC-SHA, TLS-AES-128-GCM-SHA256, TLS-AES-256-GCM-SHA384, TLS-CHACHA20-POLY1305-SHA256.
    Id double
    Id.
    Priority double
    SSL/TLS cipher suites priority.
    Versions List<string>
    SSL/TLS versions that the cipher suite can be used with. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    Cipher string
    Cipher suite name. Valid values: TLS-RSA-WITH-RC4-128-MD5, TLS-RSA-WITH-RC4-128-SHA, TLS-RSA-WITH-DES-CBC-SHA, TLS-RSA-WITH-3DES-EDE-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA, TLS-RSA-WITH-AES-256-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA256, TLS-RSA-WITH-AES-256-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-RSA-WITH-SEED-CBC-SHA, TLS-RSA-WITH-ARIA-128-CBC-SHA256, TLS-RSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-RSA-WITH-DES-CBC-SHA, TLS-DHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA, TLS-DHE-RSA-WITH-AES-256-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA256, TLS-DHE-RSA-WITH-AES-256-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-RSA-WITH-SEED-CBC-SHA, TLS-DHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-RC4-128-SHA, TLS-ECDHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA, TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-AES-128-GCM-SHA256, TLS-DHE-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-AES-128-CBC-SHA, TLS-DHE-DSS-WITH-AES-256-CBC-SHA, TLS-DHE-DSS-WITH-AES-128-CBC-SHA256, TLS-DHE-DSS-WITH-AES-128-GCM-SHA256, TLS-DHE-DSS-WITH-AES-256-CBC-SHA256, TLS-DHE-DSS-WITH-AES-256-GCM-SHA384, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384, TLS-RSA-WITH-AES-128-GCM-SHA256, TLS-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-DSS-WITH-SEED-CBC-SHA, TLS-DHE-DSS-WITH-ARIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-DSS-WITH-3DES-EDE-CBC-SHA, TLS-DHE-DSS-WITH-DES-CBC-SHA, TLS-AES-128-GCM-SHA256, TLS-AES-256-GCM-SHA384, TLS-CHACHA20-POLY1305-SHA256.
    Id float64
    Id.
    Priority float64
    SSL/TLS cipher suites priority.
    Versions []string
    SSL/TLS versions that the cipher suite can be used with. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    cipher string
    Cipher suite name. Valid values: TLS-RSA-WITH-RC4-128-MD5, TLS-RSA-WITH-RC4-128-SHA, TLS-RSA-WITH-DES-CBC-SHA, TLS-RSA-WITH-3DES-EDE-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA, TLS-RSA-WITH-AES-256-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA256, TLS-RSA-WITH-AES-256-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-RSA-WITH-SEED-CBC-SHA, TLS-RSA-WITH-ARIA-128-CBC-SHA256, TLS-RSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-RSA-WITH-DES-CBC-SHA, TLS-DHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA, TLS-DHE-RSA-WITH-AES-256-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA256, TLS-DHE-RSA-WITH-AES-256-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-RSA-WITH-SEED-CBC-SHA, TLS-DHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-RC4-128-SHA, TLS-ECDHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA, TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-AES-128-GCM-SHA256, TLS-DHE-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-AES-128-CBC-SHA, TLS-DHE-DSS-WITH-AES-256-CBC-SHA, TLS-DHE-DSS-WITH-AES-128-CBC-SHA256, TLS-DHE-DSS-WITH-AES-128-GCM-SHA256, TLS-DHE-DSS-WITH-AES-256-CBC-SHA256, TLS-DHE-DSS-WITH-AES-256-GCM-SHA384, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384, TLS-RSA-WITH-AES-128-GCM-SHA256, TLS-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-DSS-WITH-SEED-CBC-SHA, TLS-DHE-DSS-WITH-ARIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-DSS-WITH-3DES-EDE-CBC-SHA, TLS-DHE-DSS-WITH-DES-CBC-SHA, TLS-AES-128-GCM-SHA256, TLS-AES-256-GCM-SHA384, TLS-CHACHA20-POLY1305-SHA256.
    id number
    Id.
    priority number
    SSL/TLS cipher suites priority.
    versions list(string)
    SSL/TLS versions that the cipher suite can be used with. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    cipher String
    Cipher suite name. Valid values: TLS-RSA-WITH-RC4-128-MD5, TLS-RSA-WITH-RC4-128-SHA, TLS-RSA-WITH-DES-CBC-SHA, TLS-RSA-WITH-3DES-EDE-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA, TLS-RSA-WITH-AES-256-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA256, TLS-RSA-WITH-AES-256-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-RSA-WITH-SEED-CBC-SHA, TLS-RSA-WITH-ARIA-128-CBC-SHA256, TLS-RSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-RSA-WITH-DES-CBC-SHA, TLS-DHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA, TLS-DHE-RSA-WITH-AES-256-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA256, TLS-DHE-RSA-WITH-AES-256-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-RSA-WITH-SEED-CBC-SHA, TLS-DHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-RC4-128-SHA, TLS-ECDHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA, TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-AES-128-GCM-SHA256, TLS-DHE-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-AES-128-CBC-SHA, TLS-DHE-DSS-WITH-AES-256-CBC-SHA, TLS-DHE-DSS-WITH-AES-128-CBC-SHA256, TLS-DHE-DSS-WITH-AES-128-GCM-SHA256, TLS-DHE-DSS-WITH-AES-256-CBC-SHA256, TLS-DHE-DSS-WITH-AES-256-GCM-SHA384, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384, TLS-RSA-WITH-AES-128-GCM-SHA256, TLS-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-DSS-WITH-SEED-CBC-SHA, TLS-DHE-DSS-WITH-ARIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-DSS-WITH-3DES-EDE-CBC-SHA, TLS-DHE-DSS-WITH-DES-CBC-SHA, TLS-AES-128-GCM-SHA256, TLS-AES-256-GCM-SHA384, TLS-CHACHA20-POLY1305-SHA256.
    id Double
    Id.
    priority Double
    SSL/TLS cipher suites priority.
    versions List<String>
    SSL/TLS versions that the cipher suite can be used with. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    cipher string
    Cipher suite name. Valid values: TLS-RSA-WITH-RC4-128-MD5, TLS-RSA-WITH-RC4-128-SHA, TLS-RSA-WITH-DES-CBC-SHA, TLS-RSA-WITH-3DES-EDE-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA, TLS-RSA-WITH-AES-256-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA256, TLS-RSA-WITH-AES-256-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-RSA-WITH-SEED-CBC-SHA, TLS-RSA-WITH-ARIA-128-CBC-SHA256, TLS-RSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-RSA-WITH-DES-CBC-SHA, TLS-DHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA, TLS-DHE-RSA-WITH-AES-256-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA256, TLS-DHE-RSA-WITH-AES-256-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-RSA-WITH-SEED-CBC-SHA, TLS-DHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-RC4-128-SHA, TLS-ECDHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA, TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-AES-128-GCM-SHA256, TLS-DHE-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-AES-128-CBC-SHA, TLS-DHE-DSS-WITH-AES-256-CBC-SHA, TLS-DHE-DSS-WITH-AES-128-CBC-SHA256, TLS-DHE-DSS-WITH-AES-128-GCM-SHA256, TLS-DHE-DSS-WITH-AES-256-CBC-SHA256, TLS-DHE-DSS-WITH-AES-256-GCM-SHA384, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384, TLS-RSA-WITH-AES-128-GCM-SHA256, TLS-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-DSS-WITH-SEED-CBC-SHA, TLS-DHE-DSS-WITH-ARIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-DSS-WITH-3DES-EDE-CBC-SHA, TLS-DHE-DSS-WITH-DES-CBC-SHA, TLS-AES-128-GCM-SHA256, TLS-AES-256-GCM-SHA384, TLS-CHACHA20-POLY1305-SHA256.
    id number
    Id.
    priority number
    SSL/TLS cipher suites priority.
    versions string[]
    SSL/TLS versions that the cipher suite can be used with. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    cipher str
    Cipher suite name. Valid values: TLS-RSA-WITH-RC4-128-MD5, TLS-RSA-WITH-RC4-128-SHA, TLS-RSA-WITH-DES-CBC-SHA, TLS-RSA-WITH-3DES-EDE-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA, TLS-RSA-WITH-AES-256-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA256, TLS-RSA-WITH-AES-256-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-RSA-WITH-SEED-CBC-SHA, TLS-RSA-WITH-ARIA-128-CBC-SHA256, TLS-RSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-RSA-WITH-DES-CBC-SHA, TLS-DHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA, TLS-DHE-RSA-WITH-AES-256-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA256, TLS-DHE-RSA-WITH-AES-256-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-RSA-WITH-SEED-CBC-SHA, TLS-DHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-RC4-128-SHA, TLS-ECDHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA, TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-AES-128-GCM-SHA256, TLS-DHE-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-AES-128-CBC-SHA, TLS-DHE-DSS-WITH-AES-256-CBC-SHA, TLS-DHE-DSS-WITH-AES-128-CBC-SHA256, TLS-DHE-DSS-WITH-AES-128-GCM-SHA256, TLS-DHE-DSS-WITH-AES-256-CBC-SHA256, TLS-DHE-DSS-WITH-AES-256-GCM-SHA384, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384, TLS-RSA-WITH-AES-128-GCM-SHA256, TLS-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-DSS-WITH-SEED-CBC-SHA, TLS-DHE-DSS-WITH-ARIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-DSS-WITH-3DES-EDE-CBC-SHA, TLS-DHE-DSS-WITH-DES-CBC-SHA, TLS-AES-128-GCM-SHA256, TLS-AES-256-GCM-SHA384, TLS-CHACHA20-POLY1305-SHA256.
    id float
    Id.
    priority float
    SSL/TLS cipher suites priority.
    versions Sequence[str]
    SSL/TLS versions that the cipher suite can be used with. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.
    cipher String
    Cipher suite name. Valid values: TLS-RSA-WITH-RC4-128-MD5, TLS-RSA-WITH-RC4-128-SHA, TLS-RSA-WITH-DES-CBC-SHA, TLS-RSA-WITH-3DES-EDE-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA, TLS-RSA-WITH-AES-256-CBC-SHA, TLS-RSA-WITH-AES-128-CBC-SHA256, TLS-RSA-WITH-AES-256-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-RSA-WITH-SEED-CBC-SHA, TLS-RSA-WITH-ARIA-128-CBC-SHA256, TLS-RSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-RSA-WITH-DES-CBC-SHA, TLS-DHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA, TLS-DHE-RSA-WITH-AES-256-CBC-SHA, TLS-DHE-RSA-WITH-AES-128-CBC-SHA256, TLS-DHE-RSA-WITH-AES-256-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-RSA-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-RSA-WITH-SEED-CBC-SHA, TLS-DHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-DHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-RC4-128-SHA, TLS-ECDHE-RSA-WITH-3DES-EDE-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA, TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-CHACHA20-POLY1305-SHA256, TLS-DHE-RSA-WITH-AES-128-GCM-SHA256, TLS-DHE-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-AES-128-CBC-SHA, TLS-DHE-DSS-WITH-AES-256-CBC-SHA, TLS-DHE-DSS-WITH-AES-128-CBC-SHA256, TLS-DHE-DSS-WITH-AES-128-GCM-SHA256, TLS-DHE-DSS-WITH-AES-256-CBC-SHA256, TLS-DHE-DSS-WITH-AES-256-GCM-SHA384, TLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA, TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256, TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384, TLS-RSA-WITH-AES-128-GCM-SHA256, TLS-RSA-WITH-AES-256-GCM-SHA384, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA, TLS-DHE-DSS-WITH-CAMELLIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-CAMELLIA-256-CBC-SHA256, TLS-DHE-DSS-WITH-SEED-CBC-SHA, TLS-DHE-DSS-WITH-ARIA-128-CBC-SHA256, TLS-DHE-DSS-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-RSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-RSA-WITH-ARIA-256-CBC-SHA384, TLS-ECDHE-ECDSA-WITH-ARIA-128-CBC-SHA256, TLS-ECDHE-ECDSA-WITH-ARIA-256-CBC-SHA384, TLS-DHE-DSS-WITH-3DES-EDE-CBC-SHA, TLS-DHE-DSS-WITH-DES-CBC-SHA, TLS-AES-128-GCM-SHA256, TLS-AES-256-GCM-SHA384, TLS-CHACHA20-POLY1305-SHA256.
    id Number
    Id.
    priority Number
    SSL/TLS cipher suites priority.
    versions List<String>
    SSL/TLS versions that the cipher suite can be used with. Valid values: ssl-3.0, tls-1.0, tls-1.1, tls-1.2, tls-1.3.

    ObjectFirewallVipDynamicMapping_Scope, ObjectFirewallVipDynamicMapping_ScopeArgs

    Name string
    Name.
    Vdom string
    Vdom.
    Name string
    Name.
    Vdom string
    Vdom.
    name string
    Name.
    vdom string
    Vdom.
    name String
    Name.
    vdom String
    Vdom.
    name string
    Name.
    vdom string
    Vdom.
    name str
    Name.
    vdom str
    Vdom.
    name String
    Name.
    vdom String
    Vdom.

    Import

    ObjectFirewall VipDynamicMapping can be imported using any of these accepted formats:

    Set import_options = [“vip=YOUR_VALUE”] in the provider section.

    $ export “FORTIMANAGER_IMPORT_TABLE”=“true”

    $ pulumi import fortimanager:index/objectFirewallVipDynamicMapping:ObjectFirewallVipDynamicMapping labelname {{_scope.name}}.{{_scope.vdom}}
    

    $ unset “FORTIMANAGER_IMPORT_TABLE”

    -> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.

    To learn more about importing existing cloud resources, see Importing resources.

    Package Details

    Repository
    fortimanager fortinetdev/terraform-provider-fortimanager
    License
    Notes
    This Pulumi package is based on the fortimanager Terraform Provider.
    Viewing docs for fortimanager 1.17.0
    published on Monday, May 4, 2026 by fortinetdev

      Try Pulumi Cloud free.
      Your team will thank you.

      Start free trial